contact us
randstad
    • job search
      • submit your cv
      • contract roles
      • current job openings
      • cxo roles
      • job fairs
      • permanent roles
    • operational jobs
      • engineering
      • manufacturing
      • supply chain & logistics
    • professional jobs
      • banking sales
      • education
      • finance & accounting
      • healthcare
      • hr & admin support
      • ites/gcc
      • legal & compliance
      • sales & marketing
    • work with randstad
      • join our team
      • my randstad
      • refer a friend
    • ongoing hiring drives
      • banking finance and sales jobs
      • financial product sales jobs
    • operational
      • engineering
      • manufacturing
      • supply chain & logistics
    • professional
      • banking finance sales
      • finance & accounting
      • hr & support
      • ites/gcc
      • legal & compliance
      • pharma healthcare & lifesciences
      • sales & trade marketing
      • wholesale & retail
    • executive (cxo roles)
      • faqs
      • join talent pool
      • latest jobs
    • digital
      • cloud & infrastructure
      • customer experience
      • data & analytics
      • digital product & engineering
    • career advice
      • beware of job scams
      • career tests
      • career tips
      • interview tips
      • job profiles
      • job search advice
      • job seeker toolkit
      • resume tips
    • randstad bridging futures program
      • join our talent community
      • register your institute
    • submit a vacancy
      • request a callback
    • operational
      • engineering
      • manufacturing
      • supply chain & logistics
    • professional
      • banking finance sales
      • finance & accounting
      • hr & support
      • ites/gcc
      • legal & compliance
      • pharma, healthcare & lifesciences
      • sales & trade marketing
      • wholesale & retail
    • digital
      • global talent centers
      • managed solutions
      • talent services
    • enterprise
      • advisory
      • talent acquisition
      • talent development
      • talent transition
    • our services
      • executive search
      • hire-to-retire
      • managed services
      • payroll
      • perm recruitment
      • talent acquisition
      • talent export
      • temp recruitment
      • workforce advisory
    • workforce insights
      • ed&i
      • employer brand research
      • salary trends
      • startup hiring
      • talent insights
      • talent pulse surveys
      • workmonitor
    • testimonials
      • for employer
      • for talent
    • audio library
      • diversity series
      • mind matters series
    • blogs
      • employer branding
      • hr trends
      • workforce management
    • press room
      • industry insights
      • randstad in the news
    • case studies
    • our history
      • ed&i
      • our sponsorships
      • sustainability
    • offices
      • bengaluru
      • chennai
      • hyderabad
      • kolkata
      • mumbai
      • new delhi
      • view all
  • 0
randstad
    • job search
      • submit your cv
      • contract roles
      • current job openings
      • cxo roles
      • job fairs
      • permanent roles
    • operational jobs
      • engineering
      • manufacturing
      • supply chain & logistics
    • professional jobs
      • banking sales
      • education
      • finance & accounting
      • healthcare
      • hr & admin support
      • ites/gcc
      • legal & compliance
      • sales & marketing
    • work with randstad
      • join our team
      • my randstad
      • refer a friend
    • ongoing hiring drives
      • banking finance and sales jobs
      • financial product sales jobs
    • operational
      • engineering
      • manufacturing
      • supply chain & logistics
    • professional
      • banking finance sales
      • finance & accounting
      • hr & support
      • ites/gcc
      • legal & compliance
      • pharma healthcare & lifesciences
      • sales & trade marketing
      • wholesale & retail
    • executive (cxo roles)
      • faqs
      • join talent pool
      • latest jobs
    • digital
      • cloud & infrastructure
      • customer experience
      • data & analytics
      • digital product & engineering
    • career advice
      • beware of job scams
      • career tests
      • career tips
      • interview tips
      • job profiles
      • job search advice
      • job seeker toolkit
      • resume tips
    • randstad bridging futures program
      • join our talent community
      • register your institute
    • submit a vacancy
      • request a callback
    • operational
      • engineering
      • manufacturing
      • supply chain & logistics
    • professional
      • banking finance sales
      • finance & accounting
      • hr & support
      • ites/gcc
      • legal & compliance
      • pharma, healthcare & lifesciences
      • sales & trade marketing
      • wholesale & retail
    • digital
      • global talent centers
      • managed solutions
      • talent services
    • enterprise
      • advisory
      • talent acquisition
      • talent development
      • talent transition
    • our services
      • executive search
      • hire-to-retire
      • managed services
      • payroll
      • perm recruitment
      • talent acquisition
      • talent export
      • temp recruitment
      • workforce advisory
    • workforce insights
      • ed&i
      • employer brand research
      • salary trends
      • startup hiring
      • talent insights
      • talent pulse surveys
      • workmonitor
    • testimonials
      • for employer
      • for talent
    • audio library
      • diversity series
      • mind matters series
    • blogs
      • employer branding
      • hr trends
      • workforce management
    • press room
      • industry insights
      • randstad in the news
    • case studies
    • our history
      • ed&i
      • our sponsorships
      • sustainability
    • offices
      • bengaluru
      • chennai
      • hyderabad
      • kolkata
      • mumbai
      • new delhi
      • view all
contact us
    Loading...Loading...
  • find a job
    find a job
    • explore all jobs
    • submit your cv
    • join our team
    • refer a friend
  • for talents
    for talents
    • specialisms
    • testimonials
    • career advice
    • beware of job scams
  • for employers
    for employers
    • submit a vacancy
    • request a callback
    • our services
    • specialisms
    • case studies
    • testimonials
  • resources
    resources
    • case studies
    • press room
    • blogs
  • workforce insights
    workforce insights
    • talent insights reports
    • employer brand research reports
    • salary trends reports
    • ed&i reports
    • workmonitor reports
    • startup hiring trends
    • talent pulse surveys
  • jobs
    jobs
    • engineering jobs
    • cxo jobs
    • manufacturing jobs
    • supply chain & logistics jobs
    • education jobs
    • finance & accounting jobs
    • healthcare jobs
    • hr & admin support jobs
    • ites/gcc jobs
    • legal & compliance jobs
    • sales & marketing jobs
  • click here to view our linkedin
  • terms & conditions
  • cookies
  • misconduct reporting procedure
  • accessibility
  • be aware
  • sitemap
  • privacy statement

registered office: Randstad India Private Limited, CIN U74210TN1992PTC023097,/Randstad House, Old No. 5 & 5A, New No. 9, Pycrofts Garden Road, Nungambakkam, Chennai, TN - 600 006

RANDSTAD, home, HUMAN FORWARD and SHAPING THE WORLD OF WORK are registered trademarks of © Randstad N.V.2023

  • Security Advice: Randstad India does not charge any fee at any stage of its recruitment process from the candidate nor allows their employees to collect any fees from any candidates. Click here to know more 
  • EEO Statement: Randstad India is an Equal Employment Opportunity Employer. All qualified applicants receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity or expression, appearance, national origin, age, marital status, veteran status, or disability status, or any other characteristics. Our global mission is to become the world’s most equitable and specialized talent company, and we actively embrace diversity and inclusion as the cornerstones of our success. To read more of Randstad India's work in the space of equity, diversity and inclusion please click here

 

    Loading...Loading...
technicians and engineers not elsewhere classified
  • home
  • jobs
  • mechanical- and industrial engineers
  • technicians and engineers not elsewhere classified
  • sr engineer
search for
use current location
where

8 sr engineer jobs found for you.

filter3
filters:
location
location & range
where
use current location
clear filter
job types
job types
type of employment
clear filter
3professional field
our professional fields
  • (Scientific) Research
    • Chemists, Microbiologists And Process Technologists
      • Chemical Manufacturing Quality Technician
      • Chemist
      • R & D Technical Officer
      • Research Analyst
      • Research Specialist
    • Natural Scientists
      • Clinical Trial Administrator
      • Energy Analyst
      • Forest & Nature Management
      • Medical Advisor
      • Medical Liaison
      • Meter Reader - Water Meter
      • Research Associate
    • R&D Managers
      • Drawing Office Executive
      • Engineering Director
      • Manager- Engineering
      • Product Engineering Manager
      • Research And Development Manager
    • Social Scientists
      • Political Scientist
  • Administrative
    • Administrative Employees
      • Advisor
      • Back Office Executive
      • Office Clerk
      • Purchase Assistant
    • Data Entry Employees
      • Clinical Coder
      • Data Entry Executive
      • Healthcare Team Leader
  • Architecture & Urban Planning
    • Architects, Developers, Modellers And Cartographers
      • Mobility Services Manager
      • Surveyor
  • Business Management
    • Business And Administrative Services Managers
      • Assistant Manager-Project
      • Associate Regulatory
      • Compliance Manager
      • Contract Associates
      • Contract Commercial
      • Credit Control Officer
      • Delivery Manager - Businees Ops
      • Department Head
      • Development Manager
      • Fleet Operation Manager
      • Government Affairs Manager
      • Group Leader
      • Head Of Planning
      • Head Of Technical Services
      • Legal Affairs Manager
      • Maintenance Planner
      • Manager - Planning
      • PMO Executive
      • Planner
      • Procurment Executive
      • Product Safety Manager
      • Program Manager
      • Program Manager Tech
      • Project Manager
      • Project Manager Functional Management
      • Project Supervisor
      • Service Delivery Consultant
      • Site Supervisor-Engineer
      • Strategy Analyst
      • Technical Project Manager
      • Trade Manager
      • Vice President Services
    • Managing Directors
      • Assistant Head Of Operations
      • Branch Manager
      • Business Head
      • CXO Executive
      • Chief Executive Officer
      • Chief Financial Officer
      • Chief Of Police
      • Chief Technology Officer
      • Company Executive
      • Head Of Research
      • Head Operations
      • Operation Executive
      • Operation Manager
      • Partnership Manager
      • Planning & Control Manager
      • Planning Director
      • Regional Director
      • Strategic Planning Manager
      • Vice President Business Operations
      • Vice President Operations
  • Carpenters And Handymen
    • Carpenters And Handymen
      • Advertising Installer
      • Helper
      • Maintenance
      • Senior Service Technician
      • Window Installer
  • Cleaning
    • Cleaners
      • House Keeper
    • Street Sweepers And Garbage Collectors
      • Loader
    • Team Managers Housekeeping And Janitors
      • Leader
  • Creative & Design
    • Graphic Designers And Product Designers
      • Content Designer
      • Graphic Designer
      • Interior Designer
      • Packaging Engineer
      • Product Designer
      • Production Designer
    • Performing And Visual Artists
      • Musicologist
      • Radio Reporter
      • Senior Executive - Broadcast
    • Pre-press Technicians
      • Paste-up Worker
  • Data- And Business Analysis
    • Analysts And Organizational Consultants
      • Analyst
      • Associate Analyst OTC
      • BI Analyst
      • Business Intelligence Consultant
      • Business Intelligence Manager
      • Business Operations Analyst
      • Clinical Data Manager
      • Data Analyst
      • Data Reporting Analyst
      • Data Specialist
      • Inventory Analyst
      • LEAN Support Executive
      • Management Information Analyst
      • Manager Change Management
      • Material Planner
      • Occupational Analyst
      • Partner Consultant
      • Process Administrator
      • Process Analyst
      • Process Manager
      • Product Costing Specialist
      • Production Support Analyst
      • Purchasing Analyst
      • Report Writer
  • Doctors And Medical Specialists
    • Doctors
      • Hospital Physician
      • Medical Officer
      • Nephrologist
      • Oncologist
      • Radiologist
      • Resident Doctor / Welfare Officer
      • Surgeon
    • Healthcare Managers
      • Healthcare Institution Manager
      • Women's Clinic Manager
    • Medical And Pharmaceutical Specialists
      • Lab Associate
      • Lab Technician - Hospital
      • Pharmacist
    • Medical Specialists Not Elsewhere Classified
      • Animal Therapist
      • Dietician
      • Occupational Therapist
      • Optometrist
      • Speech And Language Therapist
      • Therapist
  • Education & Instruction
    • Educators And Not Elsewhere Classified Teachers
      • Assistant Manager- Instructional Designer
      • Assistant To Professor
      • Dance Teacher
      • E-learning Specialist
  • Electrical, Electronics And Hardware
    • Electricians And Electronics Technicians
      • Automotive Electrician
      • Electrician
      • Engineer Electrical Maintenance
      • Technical Services Technician
      • Telecommunications Equipment Maintainer
    • Radio And Television Technicians
      • Television Production Technician
    • Technicians And Engineers -electrical, -electronics And -hardware
      • Electrical Engineer
      • Electronics Engineer
      • Hardware Engineer
      • Senior Electrical Supervisor
  • Finance
    • Accountants And Bookkeepers
      • Account Analyst
      • Accountant
      • Accountant Fixed Assets
      • Accounting Analyst
      • Accounts Payable Specialist
      • Accounts Receivable Specialist
      • Audit
      • Audit Manager
      • Cash Management Associate
      • Cost Accountant
      • Cost Management Specialist
      • Executive - Accounts
      • Fund Accountant
      • Inventory Accountant
      • Project Controller
      • Supplier Quality Auditor
      • Tax Accountant
      • Travel Expense Auditor
      • Treasury Associate
    • Financial Advisers
      • Accounts Payable Analyst
      • Analyst Credit Management
      • Corporate Finance Associate
      • Foreclosure Specialist
      • Insurance Broker
      • Loan Specialist
      • Mortgage Loan Underwriter
      • Real Estate Analyst
      • Underwriter
    • Financial Clerks
      • Account Payable Associate
      • Billing Operations Analyst
      • Billing Specialist
      • Loan Processor
      • Property Management Assistant
    • Financial Specialists And Economists
      • AR Executive
      • Accounts Payable Manager
      • Analyst Financial Affairs
      • Analyst Financial Planning
      • Asset Manager
      • Assistant Manager - Finance
      • Atm Manager
      • Audit Analyst
      • Branch Relationship Manager
      • Business Analyst - Finance
      • Cash Management Analyst
      • Commodity Trader
      • Corporate Finance Consultant
      • Corporate Treasurer
      • Credit Manager
      • Due Diligence Analyst
      • Executive Finance
      • Finance Analyst
      • Finance Expert Consultant
      • Financial Compliance Associate
      • Financial Compliance Officer
      • Financial Controller
      • Financial Partner
      • Financial Services Specialist
      • Head Of Finance
      • Head Of Taxation
      • Hospitality Revenue Manager
      • Manager Finance
      • Middle Office Analyst
      • Risk Analyst
      • Risk Modeler
      • Securities Manager
      • Tax Advice Manager
      • Team Controller
      • Trade Analyst
      • Transaction Manager
      • Treasury Manager
      • Valuation Manager
      • Venture Capitalist
  • Goods And Materials Production
    • Assembly Workers
      • Assembler
      • Fitter
      • Mechanic
    • Process Operators
      • Nuclear Monitoring Technician
      • PLC Operator
      • Power Production Plant Operator
      • Production Engineering Technician
    • Production And Industry Managers
      • Chemical Plant Manager
      • Foundry Manager
      • Head Of Production
      • Pelleting Supervisor
      • Production Manager
      • QA Manager
      • Quality Assurance Coordinator
      • Quality Manager
      • Shift In Charge
      • Supplier Manager
      • Test Manager
      • Testing Coordinator
    • Production Machine Operators
      • Assembly Line Supervisor
      • Extruding Pressing Compacting Machinist
      • Steam Plant Operator
      • Tanner
    • Production Workers
      • Manufacturing Assistants
  • HR
    • HR Employees
      • Benefits & Compensation Consultant
      • Executive - HR & Admin
      • Executive - Sourcing
      • Executive HR And Admin
      • HR Business Partner
      • HR Executive
      • Hris Administrator
      • Human Resources Consultant
      • Payroll Analyst
      • Payroll Specialist
      • Production Trainer
      • Recruitment & Selection Coordinator
      • Recruitment Consultant
      • Sales Trainer
      • Team Leader - HR & Admin
      • Technical Recruiter
      • Training Coordinator
    • Personnel And Organization Managers
      • Executive-Talent Acquisition
      • Manager HR
      • Payroll Executive
      • Payroll Manager
      • Sales Training Manager
      • Talent Manager
  • Hair & Beauty
    • Hairdressers And Beauticians
      • Beauty Advisor
      • Manager Make Up
  • Hospitality
    • Cooks
      • Pantry Chef
    • Hospitality- And Recreation Managers
      • Head Waiter - Head Waitress
      • Spa Manager
  • IT
    • Database And Network Specialists
      • Cloud Administrator
      • Cybersecurity Risk Manager
      • Data Associate
      • Data Center Operator
      • Data Management Executive
      • Data Science Engineer
      • Data Storage & Backup Engineer
      • Data Warehouse Lead
      • Database Administrator
      • Dev Ops Engineer
      • IT Support Administrator
      • IT System Architect
      • Integration Engineer
      • Lead Oracle DBA
      • MS SQL DBA
      • Middleware Administrator
      • Ms SQL Developer
      • Network Engineer
      • Oracle EPM Developer
      • Prompt Engineer
      • SAP Security Consultant
      • SQL Developer
      • Salesforce Administrator
    • IT Managers
      • Assistant IT Manager
      • Database Coordinator
      • Embedded Systems Manager
      • IT Operations Manager
      • IT Supervisor
      • Identity Management Lead
      • Infrastructure Director
      • Manager- ERP
      • Performance Manager
      • Product Owner
      • Scrum Master
      • Senior Service Delivery Manager
      • Software Quality Assurance Manager
      • Technical Lead
    • IT User Support Specialists
      • Application Support
      • Application Support ANALYST
      • Business Assistant
      • Content Administrator
      • IT Customer Service Specialist
      • IT Officer
      • IT Support Specialist
      • MIS Executive
      • Senior Technical Support Engineer
      • Service Support Associate
      • Software Support Engineer 1
      • Technical Support Representitve
      • Web Content Manager
      • Web Content Writer
    • Software And Application Developers
      • .NET Architect
      • Android Developer
      • Application Engineer
      • Audio Software Engineer
      • Automation Tester
      • Backend Developer
      • C# .NET Developer
      • CRM Support
      • Certification Analyst
      • Cloud Engineer
      • Data Engineer
      • Embedded Engineer
      • Full Stack Developer
      • ICT Compliance Specialist
      • IT System Integration Consultant
      • Java Developer
      • Lab Engineer Firmware Verification Engineer
      • Localisation Quality Assurance Engineer
      • Microsoft Power Platform Developer
      • Python Developer
      • QA Engineer
      • SAP Expert
      • SAP Support Engineer
      • SAP Test Lead
      • Senior Analyst -Graphics And UI Designer
      • Senior PHP Developer
      • Simulation Engineer
      • Software Developer
      • Specialist - Software Development
      • Sr Java Developer
      • System Analyst
      • System Engineer
      • Technical Operations Analyst
      • UI Developer
      • User Interface Developer
      • Web Applications Architect
  • Legal
    • Lawyers
      • Deputy Attorney General
      • Facilitator
      • Pro Deo Barrister Litigator
    • Legal Employees And Related
      • Legal Executive
      • Regulatory Control Support
      • Title Closer
      • Title Researcher
  • Linguistics & Writing
    • Authors And Linguists
      • Book Reviewer
      • Content Manager
      • Documentation Technician
      • Medical Writer
      • Playwright
      • Publishing Coordinator
      • Scientific Writer
      • Translation Expert
    • Librarians And Curators
      • Document Controller
  • Machine- And Car Assembly
    • Machine Technicians
      • Marine Mechanic
  • Marketing Communications
    • Marketing, Communications And PR Managers
      • Brand Manager
      • Chief Marketing Officer
      • Communication Manager
      • Direct Marketing Director
      • Engagement Specialist
      • Industry Marketing Manager
      • Manager Marketing
      • Market Strategy Manager
      • Marketing Communication Manager
      • Product Development Director
      • Senior Manager- Media
      • Solutions Manager
      • Telecom Provider Relations Manager
      • Trade Relations Manager
    • Marketing- And PR Consultants
      • Category Manager
      • Creative Director
      • Customer Relationship Manager
      • Direct Marketing Specialist
      • Event Manager
      • Floor Ambassador
      • Marketing
      • Marketing Support
      • Out Field Counsellor - Marketing
      • Pr Representative
      • Product Analytics II
      • Product Management Associate
      • Product Manager
      • Product Manager - Meat & Meat Products
      • Product Specialist
      • Sales Marketing
      • Search Engine Optimisation Expert
      • Sem Specialist
      • Telecom Provider Relations Specialist
  • Mechanical- And Industrial Engineers
    • Technicians And Engineers -industry And Mechanical Engineering
      • Assembly Engineer
      • Associate Engineer-Heat Treatment
      • Deputy Manager - QA/QC
      • Engineer Vehicle Factory
      • Engineer- Front Axle Production
      • Flight Test Engineer
      • Instrument Technician
      • Material Stress Analyst
      • Mechanical Design Engineer
      • Mechanical Engineer
      • Mechanical Engineering Researcher
      • Metal Additive Manufacturing Operator
      • Plc Scada Engineer
      • Process Engineer
      • Process Engineering Technician
      • Service Engineer
      • Ship Assistant Engineer
      • Six Sigma Analyst
      • Six Sigma Black Belt
      • Technical Assistant
    • Technicians And Engineers Not Elsewhere Classified
      • Associate Purchase And Supplier Quality
      • Associate S
      • Automation Engineer
      • Control Engineer
      • Customer Support Engineer
      • Dcs Engineer
      • Design Engineer
      • Dft Engineer
      • EHS Engineer
      • Engineer (R&D Department)
      • Engineer SCM
      • Engineer-QC
      • Engineer-trim Operation
      • Engineering Project Manager
      • Field Service Engineer Lead
      • Maintenance Engineer
      • Prod Support Engineer
      • Reliability Engineer
      • Senior Engineer
      • Sr Engineer
      • Sr Piping Engineer
      • Telecommunications Manager
      • Trainee Quality Engineer
  • Metal
    • Metalworkers
      • CNC Operator
      • Machine Operator
      • Moulding Machine Operator
      • Screw Machinist
    • Welders And Sheet Metal Workers
      • Welder
  • Nursing & Care
    • Carers
      • Assistant Clinic
      • Home Care Provider
      • Phlebotomist
    • Specialized Nurses And Ambulance Staff
      • Nurse
      • Nursing Staff
  • Public Administration
    • Government Officials
      • Manager Control Room
    • Officials Permits, -taxes And -other
      • Tax Collections Specialist
      • Tax Specialist
    • Policy Advisers
      • Policy And Planning Specialist
    • Social Security Officials
      • Social Security Inspector
  • Quality & Control
    • Product Inspectors
      • NDT Technician
      • QA Associate
      • QA Technician
      • QC Analyst
      • QC Associate
      • QC Technician
      • Quality Analyst
      • Quality Associate
      • Quality Executive
      • Quality Inspector
    • QHSE Specialists And Consultants
      • Environmental Officer
      • HSE Associate
      • Public Health Specialist
      • Rescue Expert-Safety Engineer
      • Safety Associate
      • Safety Supervisor -M10
      • Welfar Officer
  • Recreation & Sports
    • Sports Instructors And Recreational Workers
      • Fitness Trainer
  • Remote Customer Service
    • Commercial Customer Service Workers
      • Customer Retention Associate
      • Inside Sales Executive
      • Tele Sale Executive
    • Customer Service Workers
      • CSR Officer
      • Call Centre Manager
      • Customer Support Executive
      • Data Collection Assistant
      • Incident Coordinator
      • Senior Warranty Analyst
      • Service Manager
      • Team Leader Tele Calling
  • Safety & Security
    • Police And Customs Personnel
      • Duty Officer
    • Protective Services And Security Personnel
      • Operation Centre Call Operator
      • Security Consultant
      • Support Staff Supervisor
      • Swimming Facility Attendant
  • Sales & Marketing
    • Business Service Providers
      • Music Conductor
      • Planning Associate
      • Real Estate Agent
      • Real Estate Leasing Manager
    • Buyers
      • Buying Officer
      • Ict Buyer
      • Purchase Planner
    • Commerce And Sales Managers
      • Auction House Manager
      • Bid Manager
      • Business Development Manager
      • Client Development Manager
      • Commercial Director
      • Director Account Management
      • Field Fulfillment Executive
      • Manager Sales
      • National Sales Manager
      • RSO Incharge
      • Retail Sales Director
      • Sales & Marketing Director
      • Sales Head
      • Sales Operations Director
      • Telesales Manager
      • Vendor Management
      • Vice President Sales
    • Representatives And Account Managers
      • Account Assistant
      • After-Sales Service Technician
      • Commercial Engineer
      • Contracts Commercial Asst
      • Executive - Team Lead
      • IT Account Manager
      • Key Account Manager
      • Medical Sales Representative
      • Partner Sales Representative
      • Professional Services Engineer
      • RSO Operator
      • Relationship Manager
      • Renewable Energy Sales Representative
      • Solar Energy Sales Consultant
      • Trainee Sales
    • Retail And Shopkeepers Managers
      • Assistant Store Manager
    • Sales Associates And Supermarket Staff
      • Area Sales Associate
      • Sales Assistant
      • Sales Management Assistant
      • Sales Support
      • Specialised Antique Dealer
      • Trainee - Shopfloor
  • Secretarial
    • Secretaries And Office Managers
      • Admin Executive
      • Assistant Manager - Administration
      • Collection Manager
      • Customer Service Supervisor
      • Customer Support Coordinator
      • Data Process Executive
      • Desk Manager
      • Executive Assistant
      • Management Trainee
      • Manager Admin
      • Medical Administrative Assistant
      • Medical Registrar
      • Order Manager
      • Secretary
      • Support Manager
  • Structural Work
    • Construction Labourers
      • Scaffolding Expert
    • Managers And Construction Foremen
      • Construction General Supervisor
      • Construction Manager Electrical
      • Mining Supervisor
      • Senior Electrical Supervisor
    • Mobile Machine Operators
      • Rigging Expert
  • Technicians And Engineers Road- And Hydraulic Engineering
    • Technicians And Engineers Construction
      • Civil & Structural Engineer
      • Civil Engineer
      • Civil Engineer Road Construction
      • Civil Engineering Technician
      • Project Engineer
      • Site Engineer
  • Transport
    • Delivery Drivers And Drivers Small Driving License
      • Co-driver
      • Route Driver
    • Transport Planners And Freight Forwarders
      • Dispatch Manager
      • Export Worker
      • Outbound Logistics Executive
    • Transportation Other
      • Railway Station Worker
  • Warehouse
    • Logistics Employees & Workers
      • Distribution And Scheduling Support Services
      • Lifting & Support Loading Expert
      • Logistic Management Specialist
      • Material Associate
      • Parts Assistant Workshop
      • Reach Truck Operator
      • Stock Team
      • Warehouse Assistant
      • Warehouse Executive
      • Warehouse Order Picker
    • Logistics Managers
      • Assistant Manager-Logistics
      • Export Sales Manager
      • Import Export Coordinator
      • Logistics Executive
      • Manager - Domestic Distribution
      • Manager Sourcing
      • Port Supervisor
      • Procurement Department Manager
      • SCM Executive
      • Sourcer
      • Sourcing & Procurement Manager
      • Supply Chain Director
      • Supply Chain Executive
      • Transport Executive
      • Warehouse Manager
  • Work Planners And Draughtsmen
    • Work Planners And Draughtsmen
      • CAD Engineer
      • Electrical Designer
      • Expeditor
      • Mechanical Draftsman
      • Piping Drafter
      • Supply Chain Specialist
      • Technical Publication - Illustrator
working in
job category
clear filter
all filters
all filters
where
use current location
type of employment
job category
clear filter
  • 0
selected filters:
mechanical- and industrial engineers
technicians and engineers not elsewhere classified
sr engineer
clear all
selected filters:
mechanical- and industrial engineers
technicians and engineers not elsewhere classified
sr engineer
clear all
search by
clear all
  • search for
  • where
    use current location
  • add job type
  • select the profesional field of work where you are looking for a job

    job category
our professional fields
page 1
  • sr associate

    • gurgoan, uttar pradesh
    • permanent
    PositionResponsibilities: PriortizedatagatheredfromfinancialreportsintoExcelworkbookanalysesthatprovidesvaluableguidancetotheU.S.basedengagementteamonspecificreviewsofcompanyfinancialsinthefast-pacedworldofmergersandacquisitions Prepareandupdatedocumentrequestlistsandmanagementmeetingagendas ParticipateinmanagementmeetingswiththeTargetCompanyanddiscussionswiththeClient
    28 february 2026
    PositionResponsibilities: PriortizedatagatheredfromfinancialreportsintoExcelworkbookanalysesthatprovidesvaluableguidancetotheU.S.basedengagementteamonspecificreviewsofcompanyfinancialsinthefast-pacedworldofmergersandacquisitions Prepareandupdatedocumentrequestlistsandmanagementmeetingagendas ParticipateinmanagementmeetingswiththeTargetCompanyanddiscussionswiththeClient
    show job details
  • jr. engineer

    • pune, maharashtra
    • temporary
    Job Title-Junior Engineering  Reporting Supervisor :  DE / AME JOB PROFILE (E – Essential) Qualification (E)           Diploma /ITIOverall Experience       3 – 5 yearsIndustry Type                IT Company & Manufacturing Company Industry Experience     3-5 yearTechnical Skills (E)      M&E Related Equipment’s, MS Office & Mail communication Generic Skills (E)         Communication, InterpersonalBehaviors                     Achievement level, Team work,
    24 february 2026
    Job Title-Junior Engineering  Reporting Supervisor :  DE / AME JOB PROFILE (E – Essential) Qualification (E)           Diploma /ITIOverall Experience       3 – 5 yearsIndustry Type                IT Company & Manufacturing Company Industry Experience     3-5 yearTechnical Skills (E)      M&E Related Equipment’s, MS Office & Mail communication Generic Skills (E)         Communication, InterpersonalBehaviors                     Achievement level, Team work,
    show job details
  • sr supervisor

    • satpura, madhya pradesh
    • temporary
    Senior Installation Supervisor (Contract) - Bhopal, MPWe are seeking a highly experienced and proactive Senior Installation Supervisor to join our team on a contract basis in Bhopal, Madhya Pradesh. The ideal candidate will possess a strong background in installations, with specific expertise in KAVACH systems, railways, and monitoring relay wiring. This role requires a meticulous individual capable of overseeing complex projects and ensuring successful
    3 february 2026
    Senior Installation Supervisor (Contract) - Bhopal, MPWe are seeking a highly experienced and proactive Senior Installation Supervisor to join our team on a contract basis in Bhopal, Madhya Pradesh. The ideal candidate will possess a strong background in installations, with specific expertise in KAVACH systems, railways, and monitoring relay wiring. This role requires a meticulous individual capable of overseeing complex projects and ensuring successful
    show job details
  • sr sre

    • putlibowli, telangana
    • permanent
    MAJOR RESPONSIBILITIES AND ACCOUNTABILITIES·Develop and maintain Infrastructure as Code (IaC) using tools like Terraform, Ansible, Dynatrace to automate deployment and management of infrastructure.·Build and manage CI/CD pipelines to ensure efficient and reliable application deployments.·Improve infrastructure provisioning and configuration through automation, minimizing manual interventions and reducing human error.·Monitor the health, performance, and
    30 january 2026
    MAJOR RESPONSIBILITIES AND ACCOUNTABILITIES·Develop and maintain Infrastructure as Code (IaC) using tools like Terraform, Ansible, Dynatrace to automate deployment and management of infrastructure.·Build and manage CI/CD pipelines to ensure efficient and reliable application deployments.·Improve infrastructure provisioning and configuration through automation, minimizing manual interventions and reducing human error.·Monitor the health, performance, and
    show job details
  • sr professional procurement 

    • bhubaneswar, odisha
    • temporary
    Job Title- Procurement Jr. Professional Job Location- Bhubaneswar OdishaWorking Day- 6 Slary upto - 9 LPA  Experience Minimum 3 Years in handling high value contracts for different services such as Mining, Geology, Project, Plant & Machinery, Operation & Maintenance, Civil Works, Manpower, IT Services etc. Experience & knowledge in SAP MM Module/ e-procurement/ GeM Portal/ Procurement in Govt. sector/ PSU (Other keywords: Materials management, Logistics
    29 january 2026
    Job Title- Procurement Jr. Professional Job Location- Bhubaneswar OdishaWorking Day- 6 Slary upto - 9 LPA  Experience Minimum 3 Years in handling high value contracts for different services such as Mining, Geology, Project, Plant & Machinery, Operation & Maintenance, Civil Works, Manpower, IT Services etc. Experience & knowledge in SAP MM Module/ e-procurement/ GeM Portal/ Procurement in Govt. sector/ PSU (Other keywords: Materials management, Logistics
    show job details
  • j - sr data engineer

    • bangalore, karnataka
    • permanent
    Data Data Engineer About Woodside Energy  We are a global energy company, providing reliable and affordable energy to help people lead better lives. Join our team at Woodside Global Solutions in Bengaluru where talent, digital expertise, and operational excellence converge to solve complex energy challenges, accelerate change, and reimagine business capabilities to support Woodside's global operations and our role in the energy transition. Founded in
    12 january 2026
    Data Data Engineer About Woodside Energy  We are a global energy company, providing reliable and affordable energy to help people lead better lives. Join our team at Woodside Global Solutions in Bengaluru where talent, digital expertise, and operational excellence converge to solve complex energy challenges, accelerate change, and reimagine business capabilities to support Woodside's global operations and our role in the energy transition. Founded in
    show job details
  • contract engineer

    • raigarh, chhattisgarh
    • permanent
    Experience & Domain Knowledge• Minimum 20 years of experience in Contracts, Claims, Arbitration, and Commercial Managementwithin EPC/Design-Build projects.• Proven track record in managing national and international projects with consultants and clients.• Expertise in PPP, EPC and DBO contract structures including drafting, interpretation, andimplementation of clauses.• Skilled in preparing, evaluating, and defending time and cost claims; well-versed in
    2 december 2025
    Experience & Domain Knowledge• Minimum 20 years of experience in Contracts, Claims, Arbitration, and Commercial Managementwithin EPC/Design-Build projects.• Proven track record in managing national and international projects with consultants and clients.• Expertise in PPP, EPC and DBO contract structures including drafting, interpretation, andimplementation of clauses.• Skilled in preparing, evaluating, and defending time and cost claims; well-versed in
    show job details
  • engineer / sr engineer

    • chennai, tamil nadu
    • permanent
    Must have competencies:Technical Skills 5-10 years of experience in software development using C++ programming language.Classified as Business Experience in preparing software architecture, design for the development of softwareproducts. Ability to create and/or read and interpret, the architecture and design diagrams. Experience in Software Development using Agile Scrum methodology. Excellent debugging skills. Excellent analytical skills and
    31 october 2025
    Must have competencies:Technical Skills 5-10 years of experience in software development using C++ programming language.Classified as Business Experience in preparing software architecture, design for the development of softwareproducts. Ability to create and/or read and interpret, the architecture and design diagrams. Experience in Software Development using Agile Scrum methodology. Excellent debugging skills. Excellent analytical skills and
    show job details
    illustration of an email being received

    let similar jobs come to you

    we will keep you updated when we have similar job postings.

    other technicians and engineers not elsewhere classified jobs

      • associate purchase and supplier quality (3)
      • automation engineer (4)
      • customer support engineer (3)
      • design engineer (4)
      • ehs engineer (6)
      • engineer scm (3)
      • engineer-qc (5)
      • maintenance engineer (3)
      • senior engineer (10)
      • telecommunications manager (4)
      • trainee quality engineer (4)