page 7 - 334 insurance analyst jobs found for you.

QUALIFICATIONS AND; EXPERIENCEEducation• Essential: B.Sc. in Chemistry / Analytical Chemistry / Applied Chemistry / FoodTechnology from recognized university• Preferred: M.Sc. in relevant field; Additional diploma/certification in AnalyticalTechniques or Quality ControlExperience• Essential: 2-5 years of hands-on experience in analytical/QC laboratory, preferablyin food processing or FMCG industry• Preferred: 1-2 years experience in NABL accredited

CompanyUPL LimitedUnit13Position1LocationDahejPayrollThird Party PayrollDepartmentQAExperienceMinimum 3 Years   DesignationChemistQualificationMSC ChemistryJob DescriptionEnsure the timeline of Online FG / dispatch FG Inspection as per protocolSAP / LIMS KnowledgeTesting of RM/In process/SFG independently in accordance with compliance requirement.Reagents/Volumetric solutions preparation & standardization related to process/SFG Analysis.Analytical skill

Must-Have Skills● Have experience with implementing automation to increase efficiency● Strong experience in JavaScript, Python, HTML/CSS● Proficient in SQL, with knowledge of Google BigQuery and/or MongoDB● Experience working with Google Cloud Platform (GCP) and related APIs● Hands-on experience scraping and parsing data from web portals and APIs● Able to design systems that scale across multiple clinics/clients● Ability to write unit tests, manage QA,

Strong in Technical (Hands on Coding Skills) Should be Individual Contributor(Core Tech Stacks: Frontend – React Js, Backend – Django, Python, Cloud – AWS / Azure & SQL)experience10

Experience with ASP.Net, .Net Core, Entity Framework and C# required Strong knowledge with database design and development preferred – SQL/NoSQL DB Experience with Google Cloud and Microsoft Azure preferred Experience with versioning control (GIT) preferred Experience in designing Restful API microservices. Hands-on experience with Apache Airflow for workflow orchestration and Kafka for real-timedata streaming. Experience with CI/CD pipelines using

As a Senior Software Engineer, you’ll be responsible for designing and delivering optimized, reliable backend components in C++. You’ll engage with global teams to ensure smooth collaboration and delivery. Responsibilities:• Build and optimize high-performance backend systems• Write clean, modular, testable C++ code• Participate in cross-team reviews, planning, and troubleshooting• Collaborate across regions to support global product goals Requirements:•

Qualification: Graduate any discipline 3+ years of overall experience in BPO from Mortgage servicing domainSkill Sets Has worked as transactional auditor or QC’r role for 2+ year in USA mortgage servicing area Work experience in Mortgage Servicing QA, Audit or Compliance Well-versed with various Servicing guidelines Exposure in Audit tool like ACES, Black Knight, Loss Mitigation System(LMS), Pyramid will beadded advantage Acceptability by the

We are looking for a Quality Manager with a Black Belt certification in Six Sigma to oversee our BPO operations quality teams. This role requires a strong understanding of Six Sigma methodologies and a proven track record of implementing successful quality improvement projects and managing quality teams. The ideal candidate will be a highly motivated and results-oriented individual with excellent communication, analytical, and problem-solving skills.Key

Experience:1+ years of programming, preferably working with biological data orequivalent knowledge through relevant practical experience Experience with programming in e.g. SAS or R Experience with clinical database technologies, data models andadvanced programming Experience with collaboration across professional and regional borders.experience3

1.Strategic Quality Leadershipquality Roadmap: Develop and execute the annual Quality Improvement Plan (QIP) to achieve "Zero PPM" and "Zero Customer Complaints."Budgeting: Manage the departmental Opex/Capex, including investments in automated inspection (AI/ML) and testing equipment.Team Mentorship: Lead a team of 10+ engineers and supervisors; foster a "Quality First" mindset through training and Kaizen initiatives.2. Process Governance & Risk

APAR INDUSTRIES LTDMANPOWER REQUISITION FORM (MRF)Job Description / Competency Profiling DesignationManager/Sr. Manager/AGMDate of requisition  Company / Division / SBUConductorLocationVadodara Function / DepartmentProjectsWork Cadre(SMC/MMC/JMC/NMC)MMC Basic Qualification    Highest QualificationBE/BTech (Electrical) MBA or Qualified ICWA Desired Experience   (Min -Max)NA Reporting to (Position)VPRange of Compensation (Min -Max)Upto 18 PA Any Special

Roles & Responsibilities:• Cost Estimation: Developing detailed cost estimates for projects, including labor, materials,equipment, and overheads.• Budget Management: Creating and managing project budgets, ensuring that costs stay withinapproved limits.• Financial Analysis: Analyzing project financials, identifying variances, and providingrecommendations to mitigate cost overruns.• Tender Preparation: Assisting in preparing tenders and proposals, ensuring

Job Responsibility: 2 – 10 years experience in RTR in shared services environment.The role requires working US hours especially during period close with options for part USA time zone coverage during the rest of the month.  Willingness to work in any shift.Skills and CapabilitiesDetailsPeople Management SkillsAbility to work as a team member in a shared services environmentAbility to collaborate effectively with diverse cultural groups, considering

Position Summary: We are seeking a dynamic and experienced Process Excellence Manager to lead strategic transformationinitiatives across business functions. The ideal candidate will bring a strong foundation in Six Sigma, processautomation, and AI/Gen AI technologies, with a proven track record of delivering impactful projects andmeasurable cost savings. This role requires a techno-functional mindset and the ability to drive innovationthrough data-driven

People Change Partner – Role BriefingRole OverviewDedicated people-focused change role based in HyderabadSits between the central Change team and HR Business PartnersFocused on the people experience of change, not traditional HR deliveryKey ResponsibilitiesDeliver structured change management initiativesBuild high-touch relationships with Hyderabad leadersSupport leadership transitions and hub setupFacilitate new hire experience during transformationDrive

Overview:We are seeking a highly motivated and experienced finance professional to join our General Ledger team. The ideal candidate should have ‘Expert’ level of understanding of General accounting and internal controls. This role will be pivotal to ensure and maintain operational efficiency and effectiveness of the GL process. Job Responsibilities: Process Lead – GL Accounting and ReportingGeneral LedgerAccountable for end-to-end accounting of the

•Proven experience in working in large scale change initiatives•Background in Finance Shared Services, experience of implementation activities to stand up new services is desirable•Experience of working with Global Stakeholders •Experience leading change activities with operational teams, including planning change interventions and coordinating/tracking the required activities to ensure successful go live events•Experience in hiring, onboarding and

Software Engineer - Level 4At WEX, we simplify the business of running a business. Our WEX Benefits solutionsreduce complexity and help manage costs of benefits administration for our clients andpartners. We are looking for passionate technologists, collaborators, and problemsolvers to join our Benefits Technology team as we build the next generation of employerbenefits solutions and services.As a Software Engineer on the WEX Benefits Technology team, you

Job Title : Data management- middle officeLocation : Hyderabad Experience : 2-4years  WORK EXPERIENCE / KNOWLEDGE: Job profile - Process - Bank loan reconciliation, validating position data, Position reconciliation between agents and lenders in the syndicated loan market. Lenders and agent banks in the syndicated loan market face many challenges in sharing and validating position information as loan assets are traded or pass through lifecycle events. Data

REQUIRED QUALIFICATIONSEducationBachelor’s degree in Information Technology, Computer Science, Engineering, or related discipline.Master’s degree preferred.Experience10–15 years of experience in IT Service Management with minimum 5 years in Change Management.Demonstrated experience establishing CAB governance in large-scale, multi-site IT environments.Hands-on experience with data center change management including infrastructure, network, and application

At WEX, we simplify the business of running a business. Our WEX Benefits solutionsreduce complexity and help manage costs of benefits administration for our clients andpartners. We are looking for passionate technologists, collaborators, and problemsolvers to join our Benefits Technology team as we build the next generation of employerbenefits solutions and services.As a Software Engineer on the WEX Benefits Technology team, you will work in a team

Senior Installation Supervisor (Contract) - Bhopal, MPWe are seeking a highly experienced and proactive Senior Installation Supervisor to join our team on a contract basis in Bhopal, Madhya Pradesh. The ideal candidate will possess a strong background in installations, with specific expertise in KAVACH systems, railways, and monitoring relay wiring. This role requires a meticulous individual capable of overseeing complex projects and ensuring successful

Job Title-Junior Engineering  Reporting Supervisor :  DE / AME JOB PROFILE (E – Essential) Qualification (E)           Diploma /ITIOverall Experience       3 – 5 yearsIndustry Type                IT Company & Manufacturing Company Industry Experience     3-5 yearTechnical Skills (E)      M&E Related Equipment’s, MS Office & Mail communication Generic Skills (E)         Communication, InterpersonalBehaviors                     Achievement level, Team work,

PositionResponsibilities: PriortizedatagatheredfromfinancialreportsintoExcelworkbookanalysesthatprovidesvaluableguidancetotheU.S.basedengagementteamonspecificreviewsofcompanyfinancialsinthefast-pacedworldofmergersandacquisitions Prepareandupdatedocumentrequestlistsandmanagementmeetingagendas ParticipateinmanagementmeetingswiththeTargetCompanyanddiscussionswiththeClient

MAJOR RESPONSIBILITIES AND ACCOUNTABILITIES·Develop and maintain Infrastructure as Code (IaC) using tools like Terraform, Ansible, Dynatrace to automate deployment and management of infrastructure.·Build and manage CI/CD pipelines to ensure efficient and reliable application deployments.·Improve infrastructure provisioning and configuration through automation, minimizing manual interventions and reducing human error.·Monitor the health, performance, and

Data Data Engineer About Woodside Energy  We are a global energy company, providing reliable and affordable energy to help people lead better lives. Join our team at Woodside Global Solutions in Bengaluru where talent, digital expertise, and operational excellence converge to solve complex energy challenges, accelerate change, and reimagine business capabilities to support Woodside's global operations and our role in the energy transition. Founded in

Experience & Domain Knowledge• Minimum 20 years of experience in Contracts, Claims, Arbitration, and Commercial Managementwithin EPC/Design-Build projects.• Proven track record in managing national and international projects with consultants and clients.• Expertise in PPP, EPC and DBO contract structures including drafting, interpretation, andimplementation of clauses.• Skilled in preparing, evaluating, and defending time and cost claims; well-versed in

Job Title- Procurement Jr. Professional Job Location- Bhubaneswar OdishaWorking Day- 6 Slary upto - 9 LPA  Experience Minimum 3 Years in handling high value contracts for different services such as Mining, Geology, Project, Plant & Machinery, Operation & Maintenance, Civil Works, Manpower, IT Services etc. Experience & knowledge in SAP MM Module/ e-procurement/ GeM Portal/ Procurement in Govt. sector/ PSU (Other keywords: Materials management, Logistics

Candidate should have extremely good knowledge of US mortgage live underwriting process.Candidate should have experience in conditioning underwriting process.Candidate should have minimum 2-5 years of experience in UW mortgage underwriting.Requires critically to support the development, testing, and implementation of new automated underwriting condition rules and systems.Sound knowledge of different Underwriting guidelines.Candidate should be logically

We are hiring for Condition Automation Underwriter for US mortgage industry . Working mode-Remote Shift- US shift Working days- 5 days Notice - Immediate to 30 days Candidate should have extremely good knowledge of US mortgage live underwriting process.Candidate should have experience in conditioning underwriting process.Candidate should have minimum 3-6 years of experience in UW mortgage underwriting.Requires critically to support the development,