page 4 - 528 manufacturing engineer jobs found for you.

Senior Design EngineerExperience Level: 8+Qualification: B.Sc/M.Sc or BE in Mechanical Engineering or Marine EngineerReports To: Technical Manager (Local)Job SummaryThe Technical Lead is responsible for managing all technical requirements within customer projects, serving as the main driver for all technical solutions within the project scope. This role requires overseeing the entire technical design process, from initial concept through production

1. Conduct time & motion studies, line balancing, and capacity analysis.                                                                                                                     2. Analyse and improve manufacturing and service processes for higher productivity and efficiency.                                                                                                                      3. Optimize manpower, layout, material flow, and space

EHS Engineer Qualification - ITI /DiplomaExp- 4- 9 yearsLocation- Mukundpur , Delhi Degree or Diploma in Engineering (Electrical or Mechanical)Industrial Safety Diploma from a recognized Government institutionExperience 04 to 05 years. Note: At least one candidate must possess an Electrical License along with a Safety Diploma. experience6

Policy and Compliance: Implement and enforce all EHS requirements in line with company policy, client-approved plans, legal obligations, and contractual requirements. Ensure compliance with all statutory safety regulations and international standards (e.g., ISO 45001).Risk Management: Conduct regular site inspections, risk assessments, and audits to identify potential hazards and unsafe work conditions. Implement mitigation strategies and recommend

Key Responsibilities: Perform flank grinding operations on precision components using conventional and CNC grinding machines.Monitor and control grinding parameters such as speed, feed, depth of cut, and wheel selection to achieve required surface finish and dimensional accuracy.Conduct tool and wheel setting, dressing, and balancing to maintain optimal grinding performanceInspect machined parts using measuring instruments (Vernier, micrometer, height

Job DescriptionPosition: Service Engineer - AftersalesQualification: ITI / Diploma /B.E - mechanicalLocation: GujaratYears of experience: 5 to 8 YearsKey Deliverables: Equipment performance Assurance, Customer Satisfaction, Pre-DeliveryInspections, Field Technical Support, Operator Training, Warranty Extensions, AMC and Spareparts• Provide strong technical knowledge of material handling equipment, specifically unloadingmachines.• Conduct regular checkups

Data Data Engineer About Woodside Energy  We are a global energy company, providing reliable and affordable energy to help people lead better lives. Join our team at Woodside Global Solutions in Bengaluru where talent, digital expertise, and operational excellence converge to solve complex energy challenges, accelerate change, and reimagine business capabilities to support Woodside's global operations and our role in the energy transition. Founded in

MAJOR RESPONSIBILITIES AND ACCOUNTABILITIES·Develop and maintain Infrastructure as Code (IaC) using tools like Terraform, Ansible, Dynatrace to automate deployment and management of infrastructure.·Build and manage CI/CD pipelines to ensure efficient and reliable application deployments.·Improve infrastructure provisioning and configuration through automation, minimizing manual interventions and reducing human error.·Monitor the health, performance, and

PositionResponsibilities: PriortizedatagatheredfromfinancialreportsintoExcelworkbookanalysesthatprovidesvaluableguidancetotheU.S.basedengagementteamonspecificreviewsofcompanyfinancialsinthefast-pacedworldofmergersandacquisitions Prepareandupdatedocumentrequestlistsandmanagementmeetingagendas ParticipateinmanagementmeetingswiththeTargetCompanyanddiscussionswiththeClient

Job Title Engineering CoordinatorJob Location Jagiroad, Assam (On Site)Roles & Responsibilities • Act as the central coordination point between engineering disciplines (civil, structural, mechanical, piping, electrical, automation, and process). • Monitor and track engineering deliverables, schedules, and progress, ensuring alignment with EPC milestones. • Facilitate interdisciplinary reviews, design freeze meetings, and technical interface resolution. •

Support EngineerDescriptionAs a Support Engineer, you will be part of a team responsible for supporting existing file ingestion schedules, systems, and addressing ad-hoc requests from internal and external stakeholders. These requests are critical for business operations and require timely resolution. You will identify and drive architectural changes to improve internal processes and collaborate with other engineers to ensure optimal performance and

DFT engineer3 to 8 years expriencelocation bangalore ATPG,SCAN,MBIST,experience8

Job Responsibilities:1. Creating High-Quality Content for Various AI Models:○ Develop conversational prompts and responses.○ Create generative prompts and responses.○ Write description prompts.○ Provide detailed descriptions of videos with or without audio.○ Summarize video content.○ Generate image captions.○ Create video event captions.2. Evaluating Human or AI-Generated Prompt-Response Pairs:○ Score prompt-response pairs on multiple parameters and

Job Description: The aim of the Service Engineer is to provide with service and technical support to the customers. Develop and maintain regular contacts with customers for long time agreement at all levels. Implement the service plan to increase the customer satisfaction.In this role your responsibilities are:· Execute the service plan effectively· Handle installation/ startup of electric tools· Executing Annual service agreements· Handle Customer

Are you an aspiring engineer looking to gain practical experience in facility management? Do you possess a foundational understanding of electrical systems and a desire to contribute to operational efficiency? This proactive opportunity is designed for individuals ready to make a tangible impact.Junior EngineerCompany OverviewWe are seeking a Junior Engineer for a prominent client in the Facility Management sector, known for its commitment to maintaining

To ensure secure, compliant, and timely data sanitization of end‑user computing devices and other in‑scope hardware during asset release, retag, offboarding, or disposal.Perform data wiping using Blancco / BitRaser tools.Generate and attach sanitization logs.Validate PM/DM approvals for any exceptions.Manage ServiceNow RITMs and perform backend closures.Handle asset intake, quarantine, and maintain chain of custody.Provide audit‑ready evidence and

Roles & Responsibilities:1) BOM creation in PLM. (Items, parts lists, non-CAD objects etc.)2) Metadata corrections/update in PLM.3) CAD enrichment (3D modelling, assembly, i-assemblies)4) 3D and BOM comparison.5) CAD try-outs in Inventor.6) Change management in Enovia.7) Variant management in Enovia.8) Communicate with overseas teams on a regular basis.9) Maintain planning and status sheets.10) Estimate amount of efforts required for a task.11) Attend

Experience & Domain Knowledge• Minimum 20 years of experience in Contracts, Claims, Arbitration, and Commercial Managementwithin EPC/Design-Build projects.• Proven track record in managing national and international projects with consultants and clients.• Expertise in PPP, EPC and DBO contract structures including drafting, interpretation, andimplementation of clauses.• Skilled in preparing, evaluating, and defending time and cost claims; well-versed in

CAD Engineer (Contract) - HyderabadAre you a talented CAD Engineer with a passion for design and a knack for bringing innovative concepts to life? We are proactively seeking a skilled professional for a contract role to join our dynamic team in Hyderabad. This is an excellent opportunity to contribute your expertise in CAD, AUTOCAD, and design, with a focus on BMS and ELV systems, within a professional and formal environment.Job Details:Job Title: CAD

HSE EngineerWe are proactively seeking a dedicated HSE Engineer with 1-4 years of experience to join our team in Kochi, Kerala. This is a contract position focused on ensuring a safe and healthy work environment.Responsibilities:Conduct comprehensive safety inspections and risk assessments to identify potential hazards.Develop, implement, and monitor HSE policies and procedures in compliance with regulatory standards.Investigate incidents, accidents, and

Job purpose (Describe 1-2 sentence about the main purpose of the job)Our responsibility is to provide global support to improve the operational efficiency of all wind farms around the clock. We are committed to maintaining high quality standards through continuous wind farm troubleshooting and service.   Key accountabilities / Responsibilities: Detailed descriptions of the key areas of responsibility and decisions made by this position.·         Open to

1) To Achieve Day/Month wise plan vs actual target2) Ensure good 5S, operator safety and Discipline in Shopfloor3) Material management in Line4) To control Rejection rate in line5) Ensure ESD system in line6) Ontime Work order Closer7) To Reduce Downtime in shopfloor line8) Inventory accuracy In production Store9) SMT Process Knowlegeexperience8

Greesting From randstad ! Service,car serviceCommecial vehicle servicemachine service,technician experience5

Project Management:► Monitor project progress vis a vis budget on weekly, monthly, quarterly and yearly basis &provide feedback to ZIC for any deviation in controlled area► Coordinate with contractors and TPEs to get the work done as per specifications and with dueadherence to safety norms / practices under guidance of ZIC► Certification of Contractors’ bills based on field measurement and quantity check for onwardcertification by ZIC► Liaison with local

Business Plan & Budget:► Prepare monthly & annual plan of controlled area► Provide budget inputs of controlled area to ZIC for preparation of zonal budget2) Technical Evaluation of site:► Technical feasibility of proposed Network (PE and Steel)► Provide report on planned potential vis a vis proposed Network► Coordinate with O&M, AI & HSE to visit and review the critical cases► Prepare MOC if any required for the site► Coordinate with planning department

Qualification (E)           Diploma /ITIOverall Experience      3 – 5 yearsIndustry Type              IT Company & Manufacturing CompanyIndustry Experience    3-5 yearTechnical Skills (E)      M&E Related Equipment’s, MS Office & Mail communicationGeneric Skills (E)         Communication, InterpersonalBehaviors                    Achievement level, Team work, Learning attitude & Positive thinkingexperience6

Job Title- Procurement Jr. Professional Job Location- Bhubaneswar OdishaWorking Day- 6 Slary upto - 9 LPA  Experience Minimum 3 Years in handling high value contracts for different services such as Mining, Geology, Project, Plant & Machinery, Operation & Maintenance, Civil Works, Manpower, IT Services etc. Experience & knowledge in SAP MM Module/ e-procurement/ GeM Portal/ Procurement in Govt. sector/ PSU (Other keywords: Materials management, Logistics

Role: Purchase HeadLocation: Mumbai, Lower Parel  Key Responsibilities:1. Procurement Strategy & Planning Develop and execute procurement strategies aligned with company objectives. Source and procure raw material and bought out. Lead long term agreements with the vendors to ensure cost effectiveness and continuity of supply.2. Vendor Management: Identify, evaluate, and qualify supplier ( domestic & International) Drive supplier performance on

• Participate in control system requirement analysis.• Involved in drafting of functional specifications and detailed design specification documentation.• Perform design and development of Software, PLC and Interfaces.• Perform software implementation, system integration, testing and commissioning of advanced controlsystems for e-commerce system, material handling system, airport baggage handling systems, in-flight catering systems, robot systems and

Job Opportunity: Sales Engineer (Industrial Automation)Location: Pune, Maharashtra Job Type: Full-time Start Date: As soon as possibleCompany OverviewWe are representing a global technology leader in automation known for implementing open automation systems using proven PC-based control technology. As an economically sound global player and owner-managed family company, we provide a stable yet innovative environment. We are actively expanding our team in