98 mechanical- and industrial engineers jobs found for you.

• Strong writing, presenting and listening skills with the ability to communicate complicated conceptsto peers around the world• At least 5 years in an automation and controls environment• Bachelor's Degree/Post Graduate Diploma/Professional Degree in Engineering: Mechatronics,Electrical, Electronics, Instrumentation & Control, Automation, Industrial, Computer Systems orrelated discipline• Programming of PLC (Allen Bradley, Siemens, Schneider), HMI and

Job Title: Financial ReportingLocation: Gurugram (HO)Experience: 1 – 3 YearsDepartment: FinanceReports To: Manager / Senior Manager – Financial ReportingRole ObjectiveThe primary focus of this role is to assist in the preparation, analysis, and submission of accurate financial reports. You will ensure compliance with IRDAI regulations, Indian GAAP, and Ind AS, while supporting the month-end closing process and statutory audits.Key Responsibilities1.

Job Title: Design Engineer - Mechanical Location: Bengaluru Department: Engineering / Mechanical Systems Reports To: Principal Engineer  Job Type: Full-Time Job Summary: We are seeking a skilled and Innovative Mechanical Design Engineer to join our engineering team. The ideal  candidate will be responsible for the Designing, Developing, and improving mechanical systems, components  and products that meets functional, cost, quality and safety requirements

Job Title: Design Engineer - Mechanical Location: Bengaluru Department: Engineering / Mechanical Systems Reports To: Principal Engineer  Job Type: Full-Time Job Summary: We are seeking a skilled and Innovative Mechanical Design Engineer to join our engineering team. The ideal  candidate will be responsible for the Designing, Developing, and improving mechanical systems, components  and products that meets functional, cost, quality and safety requirements

Key Responsibilities of the QSE1. Review of Supplier Documentation (70% of Time)Review pre-verification documents such as SMDL (Supplier Master Document List), ITP (Inspection and Test Plan), and Procedures received from the Supplier.Review verification documents against requirements from the PO (Purchase Order), Project/Client specifications, Material specifications, product specific requirements,and applicable codes & standards.Create a COM document in

Key ResponsibilitiesDocumentation Management: Prepare and oversee all necessary shipping documents, including Commercial Invoices, Packing Lists, Bills of Lading (BOL), Certificates of Origin, and AES filings.Compliance & Regulations: Ensure all international shipments adhere to local and international laws. Assign correct HS (Harmonized System) Codes and monitor changes in trade agreements or tariffs.Logistics Coordination: Book shipments and negotiate

Job Title: Lead Piping Engineer (Revit) Key Skills:Autodesk Revit (Piping)Piping layouts, Isometrics, GA & Spool drawingsP&ID interpretationPipe supports & multi-disciplinary coordinationKnowledge of ASME / project standardsExperience in EPC / Oil & Gas / Process / Industrial plantsQualification:B.E / B.Tech – Mechanical or Diploma in MechanicalLocation:Bangalore / Chennai (Hybrid working flexibility)Key Responsibilities: Strong expertise in Autodesk

※Roles & Responsibility          Supplier identification for Stamping, Resin . Die cast , Spring and other Partrs Floating RFQ and get the Quaotation from supplier New supplier development for new parts and Alternate supplier for Existing. Quotation analysis and compare the Quote with 2 to 3 Supplier         New part development for engine , Transmission and body parts PO preparation and Data Entry in system SAP. Should be cost estimation , negotation

Key Responsibilities Confidential information• Design and develop injection-molded and thermo formed plastic components for use in bioprocessing (e.g. drug substance and drug product manufacturing).• Select appropriate polymers and materials based on biocompatibility, extractables/leachables profiles, sterilization compatibility, and mechanical requirements.• Work closely with cross-functional teams (R&D, Manufacturing, Quality, Regulatory, and Supply

Job PurposeTo ensure maximum machine uptime and safety in a precision auto-component manufacturing environment (ECU, IG Coil, VTC) through effective electrical maintenance and rapid troubleshooting.Key ResponsibilitiesMaintenance & Troubleshooting: Perform breakdown, preventive (PPM), and corrective maintenance on production machinery (winding, molding, assembly lines).Systems Expertise: Troubleshoot PLCs (Siemens/Mitsubishi), VFDs, Servo drives, HMIs,

PositionEngineer - Product Engineering- ContractLevelExecutiveLocationPuneMandatory SkillsCreo expertisePlastic or Casting design experience is preferredGood To Have skillsbasic of surface design/surface modelling/PLMDFMEA, DFXHiring ManagerVijay NadgeriCompetitors/ Domain companiesAnyExperienceBachelor of Engineering degree with min. 1-4 years of relevant experienceDiploma with min. 4-5 years of relevant

JOB DESCRIPTION Position TitleStructural Senior EngineerDivision / DepartmentStructural Analysis/ StructuresLocationPuneDate (written on)Feb 2024 JOB PURPOSETo manage the assigned structural engineering scope in a project as per schedule with requisite quality. COMPANY OVERVIEW OneSubsea is a division of Schlumberger Limited, a multinational oilfield services company. OneSubsea specializes in providing integrated solutions, products, systems, and services

Key ResponsibilitiesSurface Development: Create and refine complex 3D surface models using Creo Parametric (ISDX/Interactive Surface Design Extension) and Freestyle modeling.Plastic Design Excellence: Ensure all designs incorporate essential plastic features, including draft angles, wall thickness uniformity, ribs, bosses, and parting lines.Technical Analysis: Perform curvature analysis, draft analysis, and thickness checks to ensure surface quality and

Key Deliverables (Functions / Activities)ResponsibilitiesMeasurement (KPI)Tooling maintenance based on production requirement.No of tooling deliveryOn-line trouble shooting for dimensional & die related problems.Tooling Breakdown %Follow all QMS procedures and documentations related to Tool shop100% on-time certification and ensure zero major NCInternal InteractionsRole - FunctionFrequency of InteractionPurposeProductionDailyTooling requirementsPurchase &

Conduct daily inspection of equipment, conduct tests, and promptly address any unusual situations that may arise.2.Effectively manage the budget allocated for maintenance, including resource allocation for necessary repairs and replacements.3.Enforce strict adherence to safety policies and procedures among departmental staff.4.Monitor factory operations to promptly resolve any maintenance related issues and optimize production efficiency.5. control and

Sourcing and Purchase Requisition analyst  Industry - Service IndustryLocation - Mumbai Purchase Requisition (PR) Support Review submitted PRs in the ERP/e-procurement system; ensure correct vendor, item/service descriptions, pricing, GL coding, cost center and approval routing.Track PR approvals, follow up with requesters/approvers to resolve queries and expedite approvals.Close or cancel PRs as required (partial/complete closure), ensuring appropriate

Job Description Roles & ResponsibilityDevelop Stamping process by understanding the parts drawing.Prepare Die specifications.Floating RFQ for stamping dies to Tool makersPrepare Line capacity and add capacity based on customer demand.Die design review and Manufacturing supportAchieve stamping parts accuracy and die prove outHome line trails and support for Die Maintenance.Prepare Spare parts of machines and dies order and hand over to Maintenance

Exposure in other treasury areasL/C , SBLC , BG , Buyers credit. -Working capital  term sheet review.SAP accounting - treasury transactions.Forex HedgingCash flow ManagementEDPMS & IDPMS - YES  experience10

About Woodside Energy  We are a global energy company, providing reliable and affordable energy to help people lead better lives. Join our team at Woodside Global Solutions in Bengaluru where talent, digital expertise, and operational excellence converge to solve complex energy challenges, accelerate change, and reimagine business capabilities to support Woodside's global operations and our role in the energy transition.Founded in 1954, Woodside

About Woodside Energy   We are a global energy company, providing reliable and affordable energy to help people lead better lives. Join our team at Woodside Global Solutions in Bengaluru where talent, digital expertise, and operational excellence converge to solve complex energy challenges, accelerate change, and reimagine business capabilities to support Woodside's global operations and our role in the energy transition.  Founded in 1954, Woodside

Role:  • Lead and manage procurement process for all material and service requirements of MBD• Establish procurement processes including analyzing market, reviewing supplier base, setting pricing structure, benchmarking with competitors and supplier management• Float RFPs to existing and potential suppliers in case of new material / service requirements• Oversee negotiations with approved suppliers for procurement within budget; closely monitor

Identification of components & Packages.  Understanding of datasheets.Awareness of BIOS functions, re-programming.Capable of testing of all the passive & active components.Repair related to all function failures (fault related to associated circuit)Expert to diagnose the circuit voltages & signals.experience6

Job ScopeThe candidate will serve as the principal contributor for transmission system modeling and detailing within the Drivetrain India team, ensuring high standards of modeling and drawing quality. This role may be designated as “Transmission Modeler/Detailer”. The position requires demonstrated expertise in advanced surface casting modeling and handling complex group-level assemblies.Key Duties and Responsibilities Perform modeling and detailing of

Role OverviewWe are looking for a D2C Growth Manager who will own and drive end-to-end growthacross the D2C website and digital channels. This role requires a hands-on growth leaderwho can balance performance marketing, conversion optimization, retention, and analyticsto scale revenue efficiently. Key ResponsibilitiesGrowth & Revenue• Own D2C revenue targets and growth metrics (traffic, conversion, AOV, LTV, CAC)• Build and execute growth strategies

Designation:Process accosiate Fresher -1years Duration:6monthCTC Offered:3lpaLaptop is must with Windows 10 with 16GB RAMShift :Night and rotational shift Location:Bangalore  Fluent in English – spoken and writtenProficient in MS Office, including Excel, Access and PowerPointKnowledge on Fixed Income, Equities, Derivatives & FX related products & Money Market productsExperience with vendor systems – Refinitiv & Bloomberg data feedExcellent attention to

Roles -    1)Supporting customers through technical and administrative activities   2)Understanding customer needs and concerns   3) Providing a high level of customer service   4) Preparing and submitting service reports   5) Providing technical direction to the team   6) Participating in the training of new team members   7) Work under pressure and meet tight deadlinesexperience10

Requirements: ·         Bachelor’s degree in computer science, Engineering, or related field (or equivalent work experience) ·         Minimum 4 years and not more than 7 years of overall IT experience ·         Minimum 2 years and not more than 3 years of proven experience in designing and developing RPA solutions using UiPath with a strong understanding of RPA concepts and best practices. ·         UiPath Certification is mandatory·         Proficiency

PositionResponsibilities: PriortizedatagatheredfromfinancialreportsintoExcelworkbookanalysesthatprovidesvaluableguidancetotheU.S.basedengagementteamonspecificreviewsofcompanyfinancialsinthefast-pacedworldofmergersandacquisitions Prepareandupdatedocumentrequestlistsandmanagementmeetingagendas ParticipateinmanagementmeetingswiththeTargetCompanyanddiscussionswiththeClient

Greesting From randstad ! Service,car serviceCommecial vehicle servicemachine service,technician experience5

As the Head of Research and Development (R&D) you will lead a team of talented researchers and engineers to drive innovaƟon and product development iniƟaƟves. This role requires a strategic thinker with a strong technical background, excepƟonal leadership skills, and a track record of successfully managing R&D projects in India. It will Involve close coordinaƟon and working along with our Global R&D headquarter in Germany.Key Responsibilities: Lead and