contact us
randstad
    • job search
      • submit your cv
      • contract roles
      • current job openings
      • cxo roles
      • job fairs
      • permanent roles
    • operational jobs
      • engineering
      • manufacturing
      • supply chain & logistics
    • professional jobs
      • banking sales
      • education
      • finance & accounting
      • healthcare
      • hr & admin support
      • ites/gcc
      • legal & compliance
      • sales & marketing
    • work with randstad
      • join our team
      • my randstad
      • refer a friend
    • ongoing hiring drives
      • banking finance and sales jobs
      • financial product sales jobs
    • operational
      • engineering
      • manufacturing
      • supply chain & logistics
    • professional
      • banking finance sales
      • finance & accounting
      • hr & support
      • ites/gcc
      • legal & compliance
      • pharma healthcare & lifesciences
      • sales & trade marketing
      • wholesale & retail
    • executive (cxo roles)
      • faqs
      • join talent pool
      • latest jobs
    • digital
      • cloud & infrastructure
      • customer experience
      • data & analytics
      • digital product & engineering
    • career advice
      • beware of job scams
      • career tests
      • career tips
      • interview tips
      • job profiles
      • job search advice
      • job seeker toolkit
      • resume tips
    • randstad bridging futures program
      • join our talent community
      • register your institute
    • submit a vacancy
      • request a callback
    • operational
      • engineering
      • manufacturing
      • supply chain & logistics
    • professional
      • banking finance sales
      • finance & accounting
      • hr & support
      • ites/gcc
      • legal & compliance
      • pharma, healthcare & lifesciences
      • sales & trade marketing
      • wholesale & retail
    • digital
      • global talent centers
      • managed solutions
      • talent services
    • enterprise
      • advisory
      • talent acquisition
      • talent development
      • talent transition
    • our services
      • executive search
      • hire-to-retire
      • managed services
      • payroll
      • perm recruitment
      • talent acquisition
      • talent export
      • temp recruitment
      • workforce advisory
    • workforce insights
      • ed&i
      • employer brand research
      • salary trends
      • startup hiring
      • talent insights
      • talent pulse surveys
      • workmonitor
    • testimonials
      • for employer
      • for talent
    • audio library
      • diversity series
      • mind matters series
    • blogs
      • employer branding
      • hr trends
      • workforce management
    • press room
      • industry insights
      • randstad in the news
    • case studies
    • our history
      • ed&i
      • our sponsorships
      • sustainability
    • offices
      • bengaluru
      • chennai
      • hyderabad
      • kolkata
      • mumbai
      • new delhi
      • view all
  • 0
randstad
    • job search
      • submit your cv
      • contract roles
      • current job openings
      • cxo roles
      • job fairs
      • permanent roles
    • operational jobs
      • engineering
      • manufacturing
      • supply chain & logistics
    • professional jobs
      • banking sales
      • education
      • finance & accounting
      • healthcare
      • hr & admin support
      • ites/gcc
      • legal & compliance
      • sales & marketing
    • work with randstad
      • join our team
      • my randstad
      • refer a friend
    • ongoing hiring drives
      • banking finance and sales jobs
      • financial product sales jobs
    • operational
      • engineering
      • manufacturing
      • supply chain & logistics
    • professional
      • banking finance sales
      • finance & accounting
      • hr & support
      • ites/gcc
      • legal & compliance
      • pharma healthcare & lifesciences
      • sales & trade marketing
      • wholesale & retail
    • executive (cxo roles)
      • faqs
      • join talent pool
      • latest jobs
    • digital
      • cloud & infrastructure
      • customer experience
      • data & analytics
      • digital product & engineering
    • career advice
      • beware of job scams
      • career tests
      • career tips
      • interview tips
      • job profiles
      • job search advice
      • job seeker toolkit
      • resume tips
    • randstad bridging futures program
      • join our talent community
      • register your institute
    • submit a vacancy
      • request a callback
    • operational
      • engineering
      • manufacturing
      • supply chain & logistics
    • professional
      • banking finance sales
      • finance & accounting
      • hr & support
      • ites/gcc
      • legal & compliance
      • pharma, healthcare & lifesciences
      • sales & trade marketing
      • wholesale & retail
    • digital
      • global talent centers
      • managed solutions
      • talent services
    • enterprise
      • advisory
      • talent acquisition
      • talent development
      • talent transition
    • our services
      • executive search
      • hire-to-retire
      • managed services
      • payroll
      • perm recruitment
      • talent acquisition
      • talent export
      • temp recruitment
      • workforce advisory
    • workforce insights
      • ed&i
      • employer brand research
      • salary trends
      • startup hiring
      • talent insights
      • talent pulse surveys
      • workmonitor
    • testimonials
      • for employer
      • for talent
    • audio library
      • diversity series
      • mind matters series
    • blogs
      • employer branding
      • hr trends
      • workforce management
    • press room
      • industry insights
      • randstad in the news
    • case studies
    • our history
      • ed&i
      • our sponsorships
      • sustainability
    • offices
      • bengaluru
      • chennai
      • hyderabad
      • kolkata
      • mumbai
      • new delhi
      • view all
contact us
    Loading...Loading...
  • find a job
    find a job
    • explore all jobs
    • submit your cv
    • join our team
    • refer a friend
  • for talents
    for talents
    • specialisms
    • testimonials
    • career advice
    • beware of job scams
  • for employers
    for employers
    • submit a vacancy
    • request a callback
    • our services
    • specialisms
    • case studies
    • testimonials
  • resources
    resources
    • case studies
    • press room
    • blogs
  • workforce insights
    workforce insights
    • talent insights reports
    • employer brand research reports
    • salary trends reports
    • ed&i reports
    • workmonitor reports
    • startup hiring trends
    • talent pulse surveys
  • jobs
    jobs
    • engineering jobs
    • cxo jobs
    • manufacturing jobs
    • supply chain & logistics jobs
    • education jobs
    • finance & accounting jobs
    • healthcare jobs
    • hr & admin support jobs
    • ites/gcc jobs
    • legal & compliance jobs
    • sales & marketing jobs
  • click here to view our linkedin
  • terms & conditions
  • cookies
  • misconduct reporting procedure
  • accessibility
  • be aware
  • sitemap
  • privacy statement

registered office: Randstad India Private Limited, CIN U74210TN1992PTC023097,/Randstad House, Old No. 5 & 5A, New No. 9, Pycrofts Garden Road, Nungambakkam, Chennai, TN - 600 006

RANDSTAD, home, HUMAN FORWARD and SHAPING THE WORLD OF WORK are registered trademarks of © Randstad N.V.2023

  • Security Advice: Randstad India does not charge any fee at any stage of its recruitment process from the candidate nor allows their employees to collect any fees from any candidates. Click here to know more 
  • EEO Statement: Randstad India is an Equal Employment Opportunity Employer. All qualified applicants receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity or expression, appearance, national origin, age, marital status, veteran status, or disability status, or any other characteristics. Our global mission is to become the world’s most equitable and specialized talent company, and we actively embrace diversity and inclusion as the cornerstones of our success. To read more of Randstad India's work in the space of equity, diversity and inclusion please click here

 

    Loading...Loading...
jobs
  • home
  • jobs
  • mechanical- and industrial engineers
search for
use current location
where

98 mechanical- and industrial engineers jobs found for you.

filter1
filters:
location
location & range
where
use current location
clear filter
job types
job types
type of employment
clear filter
1professional field
our professional fields
  • (Scientific) Research
    • Chemists, Microbiologists And Process Technologists
      • Chemist
      • Research And Development Analytical Associate
    • Natural Scientists
      • Clinical Trial Administrator
      • Energy Analyst
      • Forest & Nature Management
      • Medical Advisor
      • Medical Liaison
      • Meter Reader - Water Meter
      • Research Associate
    • R&D Managers
      • Drawing Office Executive
      • Manager- Engineering
      • Product Engineering Manager
      • Research And Development Manager
    • Social Scientists
      • Political Scientist
  • Administrative
    • Administrative Employees
      • Advisor
      • Back Office Executive
      • Office Clerk
      • Purchase Assistant
    • Data Entry Employees
      • Care Administration Consultant
      • Clinical Coder
      • Data Entry Executive
      • Healthcare Team Leader
  • Agricultural
    • Farmers And Horticulturists
      • Mixed Farmer
  • Architecture & Urban Planning
    • Architects, Developers, Modellers And Cartographers
      • Mobility Services Manager
      • Surveyor
  • Building Completion
    • Construction Crew Completion Work
      • HVAC Design Engineer
  • Business Management
    • Business And Administrative Services Managers
      • Assistant Manager-Project
      • Associate Regulatory
      • Business Administrator
      • Compliance Manager
      • Contract Associates
      • Contract Commercial
      • Credit Control Officer
      • Delivery Manager - Businees Ops
      • Department Head
      • Development Manager
      • Fleet Operation Manager
      • Government Contracts Manager
      • Group Leader
      • Head Of Planning
      • Legal Affairs Manager
      • Maintenance Planner
      • Manager - Administration
      • Manager - Planning
      • Planner
      • Procurment Executive
      • Product Safety Manager
      • Program Manager
      • Program Manager Tech
      • Project Control Specialist
      • Project Manager
      • Project Manager Functional Management
      • Project Supervisor
      • Service Delivery Consultant
      • Site Supervisor-Engineer
      • Vice President Services
    • Managing Directors
      • Assistant Head Of Operations
      • Branch Manager
      • Business Head
      • CXO Executive
      • Chief Executive Officer
      • Chief Financial Officer
      • Chief Technology Officer
      • Company Executive
      • Head Of Research
      • Head Operations
      • Operation Executive
      • Operation Manager
      • Partnership Manager
      • Planning & Control Manager
      • Regional Director
      • Strategic Planning Manager
      • Vice President Business Operations
      • Vice President Operations
  • Carpenters And Handymen
    • Carpenters And Handymen
      • Advertising Installer
      • Helper
      • Senior Service Technician
      • Window Installer
  • Cleaning
    • Cleaners
      • House Keeper
    • Street Sweepers And Garbage Collectors
      • Loader
  • Creative & Design
    • Graphic Designers And Product Designers
      • Content Designer
      • Graphic Designer
      • Interior Designer
      • Merchandiser
      • Packaging Engineer
      • Product Designer
    • Performing And Visual Artists
      • Extra
      • Musicologist
      • Radio Reporter
      • Senior Executive - Broadcast
    • Pre-press Technicians
      • Paste-up Worker
  • Data- And Business Analysis
    • Analysts And Organizational Consultants
      • Analyst
      • Analyst Clinical Data
      • Associate Analyst OTC
      • BI Analyst
      • Business Intelligence Manager
      • Business Operations Analyst
      • Clinical Data Manager
      • Data Analyst
      • Data Reporting Analyst
      • Data Specialist
      • Inventory Analyst
      • LEAN Support Executive
      • Manager Change Management
      • Material Planner
      • Partner Consultant
      • Process Administrator
      • Process Analyst
      • Process Manager
      • Product Costing Specialist
      • Production Support Analyst
      • Purchasing Analyst
      • Report Writer
  • Doctors And Medical Specialists
    • Doctors
      • Hospital Physician
      • Medical Officer
      • Nephrologist
      • Oncologist
      • Radiologist
      • Resident Doctor / Welfare Officer
      • Surgeon
    • Healthcare Managers
      • Healthcare Institution Manager
      • Women's Clinic Manager
    • Medical And Pharmaceutical Specialists
      • Lab Associate
      • Lab Technician - Hospital
      • Pharmacist
    • Medical Specialists Not Elsewhere Classified
      • Animal Therapist
      • Dietician
      • Occupational Therapist
      • Therapist
  • Education & Instruction
    • Educators And Not Elsewhere Classified Teachers
      • Assistant Manager- Instructional Designer
      • Assistant To Professor
  • Electrical, Electronics And Hardware
    • Electricians And Electronics Technicians
      • Automotive Electrician
      • Electrician
      • Engineer Electrical Maintenance
      • Technical Services Technician
      • Telecommunications Equipment Maintainer
    • Radio And Television Technicians
      • Television Production Engineer
      • Television Production Technician
    • Technicians And Engineers -electrical, -electronics And -hardware
      • Component Engineer
      • Electrical Engineer
      • Electronics Engineer
      • Hardware Engineer
  • Finance
    • Accountants And Bookkeepers
      • Account Analyst
      • Accountant
      • Accountant Fixed Assets
      • Accounting Analyst
      • Accounts Payable Specialist
      • Accounts Receivable Specialist
      • Audit Manager
      • Cash Management Associate
      • Cost Accountant
      • Cost Management Specialist
      • Executive - Accounts
      • Fund Accountant
      • Inventory Accountant
      • Payroll Accountant
      • Supplier Quality Auditor
      • Travel Expense Auditor
      • Treasury Associate
    • Financial Advisers
      • Accounts Payable Analyst
      • Analyst Credit Management
      • Corporate Finance Associate
      • Credit Analyst
      • Foreclosure Specialist
      • Insurance Broker
      • Loan Specialist
      • Mortgage Loan Underwriter
      • Real Estate Analyst
      • Underwriter
    • Financial Clerks
      • Account Payable Associate
      • Billing Operations Analyst
      • Billing Specialist
      • Debt Recovery Executive
      • Loan Processor
      • Property Management Assistant
    • Financial Specialists And Economists
      • AR Executive
      • Accounts Payable Manager
      • Analyst Financial Affairs
      • Analyst Financial Planning
      • Asset Manager
      • Assistant Manager - Finance
      • Atm Manager
      • Audit Analyst
      • Branch Relationship Manager
      • Business Analyst - Finance
      • Cash Management Analyst
      • Checker
      • Commodity Trader
      • Corporate Finance Consultant
      • Corporate Treasurer
      • Credit Manager
      • Due Diligence Analyst
      • Executive Finance
      • Finance Analyst
      • Finance Expert Consultant
      • Financial Compliance Associate
      • Financial Compliance Officer
      • Financial Controller
      • Financial Partner
      • Financial Planning Analysis Controller
      • Financial Services Specialist
      • Fp&a Manager
      • Head Of Finance
      • Head Of Taxation
      • Hospitality Revenue Manager
      • Ifrs Consultant
      • Know Your Client (KYC) Operator
      • Manager Finance
      • Middle Office Analyst
      • Risk Analyst
      • Risk Modeler
      • Securities Manager
      • Tax Advice Director
      • Tax Advice Manager
      • Team Controller
      • Trade Analyst
      • Transaction Manager
      • Treasury Manager
      • Valuation Manager
      • Venture Capitalist
      • Vice President Accounting
  • Goods And Materials Production
    • Assembly Workers
      • Assembly Operator Electrical
      • Fitter
      • Mechanic
    • Process Operators
      • Nuclear Monitoring Technician
      • PLC Operator
      • Power Production Plant Operator
      • Production Engineering Technician
    • Production And Industry Managers
      • Foundry Manager
      • Head Of Production
      • Pelleting Supervisor
      • Production Manager
      • QA Manager
      • Quality Assurance Coordinator
      • Quality Manager
      • Shift In Charge
      • Supplier Manager
      • Testing Coordinator
    • Production Machine Operators
      • Instrument Operator
      • Steam Plant Operator
      • Tanner
    • Production Workers
      • Manufacturing Assistants
      • Production Assistant
  • HR
    • HR Employees
      • Benefits & Compensation Consultant
      • Executive - HR & Admin
      • Executive - Sourcing
      • Executive HR And Admin
      • HR Business Partner
      • HR Co-ordinator
      • HR Executive
      • Human Resources Consultant
      • Payroll Analyst
      • Payroll Specialist
      • Recruitment Consultant
      • Team Leader - HR & Admin
      • Technical Recruiter
      • Training Coordinator
    • Personnel And Organization Managers
      • Executive-Talent Acquisition
      • Manager HR
      • Payroll Executive
      • Payroll Manager
      • Sales Training Manager
      • Talent Manager
  • Hair & Beauty
    • Hairdressers And Beauticians
      • Beauty Advisor
      • Manager Make Up
  • Hospitality
    • Cooks
      • Pantry Chef
    • Hospitality- And Recreation Managers
      • Head Waiter - Head Waitress
      • Spa Manager
  • IT
    • Database And Network Specialists
      • Cybersecurity Risk Manager
      • Data Associate
      • Data Center Operator
      • Data Management Executive
      • Data Science Engineer
      • Database Administrator
      • Dev Ops Engineer
      • Executive Dam Operations
      • IT Support Administrator
      • IT System Architect
      • Integration Engineer
      • MS SQL DBA
      • Ms SQL Developer
      • Network Engineer
      • Oracle EPM Developer
      • Prompt Engineer
      • SAP Security Consultant
      • SQL Developer
      • Salesforce Administrator
      • Trainee Database Analyst
    • IT Managers
      • Applications Director
      • Database Coordinator
      • Embedded Systems Manager
      • IT Operations Manager
      • IT Program Manager
      • IT Supervisor
      • Identity Management Lead
      • Infrastructure Director
      • Manager- ERP
      • Performance Manager
      • Product Owner
      • Scrum Master
      • Senior Service Delivery Manager
      • Software Quality Assurance Manager
      • Technical Lead
    • IT User Support Specialists
      • Application Support
      • Application Support ANALYST
      • Business Assistant
      • Content Administrator
      • Helpdesk Executive
      • IT Customer Service Specialist
      • IT Officer
      • IT Support Specialist
      • MIS Executive
      • Senior Technical Support Engineer
      • Service Support Associate
      • Software Support Engineer 1
      • Technical Support Representitve
      • Web Content Manager
      • Web Content Writer
    • Software And Application Developers
      • .NET Architect
      • ABAP Consultant
      • Analyst Software Quality Monitoring
      • Audio Software Engineer
      • Automation Tester
      • Backend Developer
      • C# .NET Developer
      • CRM Support
      • Certification Analyst
      • Cloud Engineer
      • Data Engineer
      • Embedded Engineer
      • Full Stack Developer
      • ICT Compliance Specialist
      • IT System Integration Consultant
      • Infrastructure Engineer
      • Java Developer
      • Lab Engineer Firmware Verification Engineer
      • Localisation Quality Assurance Engineer
      • Microsoft Power Platform Developer
      • Python Developer
      • QA Engineer
      • SAP Expert
      • SAP Support Engineer
      • Senior Analyst -Graphics And UI Designer
      • Senior PHP Developer
      • Simulation Engineer
      • Software Developer
      • Sr Java Developer
      • System Analyst
      • System Engineer
      • Technical Operations Analyst
      • UI Developer
      • User Experience Designer
      • User Interface Developer
      • Web Applications Architect
  • Legal
    • Lawyers
      • Deputy Attorney General
      • Facilitator
      • IT Governance Analyst
      • Pro Deo Barrister Litigator
    • Legal Employees And Related
      • Legal Executive
      • Regulatory Control Support
      • Title Closer
      • Title Researcher
  • Linguistics & Writing
    • Authors And Linguists
      • Book Reviewer
      • Content Manager
      • Documentation Technician
      • Medical Writer
      • Publishing Coordinator
      • Scientific Writer
      • Translation Expert
    • Librarians And Curators
      • Document Controller
  • Machine- And Car Assembly
    • Machine Technicians
      • Marine Mechanic
  • Marketing Communications
    • Marketing, Communications And PR Managers
      • Brand Manager
      • Channel Marketing Executive
      • Chief Marketing Officer
      • Communication Manager
      • Direct Marketing Director
      • Industry Marketing Manager
      • Manager Marketing
      • Market Strategy Manager
      • Marketing Communication Manager
      • Senior Manager- Media
      • Solutions Manager
      • Telecom Provider Relations Manager
      • Trade Relations Manager
    • Marketing- And PR Consultants
      • Category Manager
      • Creative Director
      • Customer Relationship Manager
      • Direct Marketing Specialist
      • E-commerce Manager
      • Event Manager
      • Floor Ambassador
      • Manager Social Media
      • Marketing
      • Marketing Communications Specialist
      • Marketing Support
      • Out Field Counsellor - Marketing
      • Pr Representative
      • Product Analytics II
      • Product Management Associate
      • Product Manager
      • Product Manager - Meat & Meat Products
      • Product Specialist
      • Promoter
      • Sales Marketing
      • Search Engine Optimisation Expert
      • Sem Specialist
      • Telecom Provider Relations Specialist
      • Web Analytics Specialist
  • Mechanical- And Industrial Engineers
    • Technicians And Engineers -industry And Mechanical Engineering
      • Assembly Engineer
      • Associate Engineer-Heat Treatment
      • Deputy Manager - QA/QC
      • Engineer Vehicle Factory
      • Instrument Technician
      • Material Stress Analyst
      • Mechanical Design Engineer
      • Mechanical Engineer
      • Mechanical Engineering Researcher
      • Metal Additive Manufacturing Operator
      • Plastics Engineer
      • Plc Scada Engineer
      • Process Engineer
      • Service Engineer
      • Ship Assistant Engineer
      • Six Sigma Analyst
      • Six Sigma Black Belt
      • Technical Assistant
      • Tool Engineer
    • Technicians And Engineers Not Elsewhere Classified
      • Associate Purchase And Supplier Quality
      • Automation Engineer
      • Customer Support Engineer
      • Design Engineer
      • Dft Engineer
      • EHS Engineer
      • Engineer (R&D Department)
      • Engineer SCM
      • Engineer-QC
      • Engineer-trim Operation
      • Field Service Engineer Lead
      • Lead Piping Engineer
      • Maintenance Engineer
      • Prod Support Engineer
      • Reliability Engineer
      • Reporting Engineer
      • Senior Engineer
      • Sr Engineer
      • Telecommunications Manager
      • Trainee Quality Engineer
  • Metal
    • Metalworkers
      • CNC Operator
      • Machine Operator
      • Moulding Machine Operator
    • Welders And Sheet Metal Workers
      • Welder
  • Nursing & Care
    • Carers
      • Assistant Clinic
      • Home Care Provider
      • Phlebotomist
    • Specialized Nurses And Ambulance Staff
      • Nursing Staff
  • Public Administration
    • Government Officials
      • Manager Control Room
    • Officials Permits, -taxes And -other
      • Tax Collections Specialist
      • Tax Specialist
    • Policy Advisers
      • Policy And Planning Specialist
    • Social Security Officials
      • Social Security Inspector
  • Quality & Control
    • Product Inspectors
      • NDT Technician
      • QA Associate
      • QA Technician
      • QC Analyst
      • QC Associate
      • QC Technician
      • Quality Analyst
      • Quality Associate
      • Quality Executive
      • Quality Inspector
    • QHSE Specialists And Consultants
      • Environmental Officer
      • Executive - Fire Tender
      • H&S Site Supervisor
      • HSE Associate
      • Health & Safety Officer
      • Public Health Specialist
      • Rescue Expert-Safety Engineer
      • Safety Associate
      • Safety Supervisor -M10
      • Welfar Officer
  • Recreation & Sports
    • Sports Instructors And Recreational Workers
      • Fitness Trainer
  • Remote Customer Service
    • Commercial Customer Service Workers
      • Customer Retention Associate
      • Inside Sales Executive
    • Customer Service Workers
      • CSR Officer
      • Call Centre Manager
      • Complaint Handling Coordinator
      • Customer Support Executive
      • Data Collection Assistant
      • Senior Warranty Analyst
      • Service Manager
      • Team Leader Tele Calling
      • Warranty Supervisor
  • Safety & Security
    • Police And Customs Personnel
      • Duty Officer
    • Protective Services And Security Personnel
      • Operation Centre Call Operator
      • Security Consultant
      • Support Staff Supervisor
      • Swimming Facility Attendant
  • Sales & Marketing
    • Business Service Providers
      • Music Conductor
      • Planning Associate
      • Real Estate Agent
    • Buyers
      • Buying Officer
      • Ict Buyer
      • Purchase Planner
      • Standalone Public Buyer
    • Commerce And Sales Managers
      • Auction House Manager
      • Bid Manager
      • Business Development Manager
      • Client Development Manager
      • Commercial Director
      • Director Account Management
      • Field Fulfillment Executive
      • International Sales Manager
      • Manager Sales
      • National Sales Manager
      • RSO Incharge
      • Retail Sales Director
      • Sales & Marketing Director
      • Sales Head
      • Sales Operations Director
      • Telesales Manager
      • Vendor Management
      • Vice President Sales
    • Providers Of Personal Services Not Elsewhere Classified
      • Dog Caretaker
    • Representatives And Account Managers
      • Account Assistant
      • After-Sales Service Technician
      • Contracts Commercial Asst
      • Enterprise Account Manager
      • Executive - Team Lead
      • IT Account Manager
      • Key Account Manager
      • Medical Sales Representative
      • Partner Sales Representative
      • Professional Service Specialist
      • RSO Operator
      • Relationship Manager
      • Renewable Energy Sales Representative
      • Sales Support Engineer
      • Solar Energy Sales Consultant
      • Trainee Sales
    • Retail And Shopkeepers Managers
      • Assistant Store Manager
      • Team Leader Sales
    • Sales Associates And Supermarket Staff
      • Area Sales Associate
      • Sales Assistant
      • Sales Management Assistant
      • Sales Processor
      • Sales Support
      • Specialised Antique Dealer
      • Trainee - Shopfloor
  • Secretarial
    • Secretaries And Office Managers
      • Admin Executive
      • Assistant Manager - Administration
      • Collection Manager
      • Customer Service Supervisor
      • Customer Support Coordinator
      • Data Process Executive
      • Desk Manager
      • Executive Assistant
      • Management Trainee
      • Manager Admin
      • Medical Administrative Assistant
      • Medical Registrar
      • Order Manager
      • Secretary
  • Social Care
    • Social Services Managers
      • Childcare Center Manager
  • Structural Work
    • Construction Labourers
      • Scaffolding Expert
    • Managers And Construction Foremen
      • Construction General Supervisor
      • Construction Manager Electrical
      • Mining Supervisor
      • Senior Electrical Supervisor
    • Mobile Machine Operators
      • Rigging Expert
      • Road Construction Worker
  • Technicians And Engineers Road- And Hydraulic Engineering
    • Technicians And Engineers Construction
      • Civil Engineer
      • Civil Engineer Road Construction
      • Civil Engineering Technician
      • Geotechnician
      • Project Engineer
      • Site Engineer
      • Technical Executive
  • Transport
    • Delivery Drivers And Drivers Small Driving License
      • Co-driver
      • Driver
    • Ship Crew And Pilots
      • Fighter Pilot
    • Transport Planners And Freight Forwarders
      • Dispatch Manager
      • Export Worker
      • Outbound Logistics Executive
    • Transportation Other
      • Railway Station Worker
  • Warehouse
    • Logistics Employees & Workers
      • Distribution And Scheduling Support Services
      • Lifting & Support Loading Expert
      • Logistic Management Specialist
      • Material Associate
      • Parts Assistant Workshop
      • Stock Team
      • Warehouse Assistant
      • Warehouse Executive
      • Warehouse Order Picker
    • Logistics Managers
      • Assistant Manager-Logistics
      • Import Export Coordinator
      • Logistics Executive
      • Manager - Domestic Distribution
      • Manager Sourcing
      • Port Supervisor
      • Procurement Department Manager
      • SCM Executive
      • Sourcer
      • Sourcing & Procurement Manager
      • Supply Chain Director
      • Supply Chain Executive
      • Supply Chain Systems Manager
      • Transport Executive
      • Warehouse Manager
  • Work Planners And Draughtsmen
    • Work Planners And Draughtsmen
      • Architectural Drafter
      • CAD Engineer
      • Expeditor
      • Mechanical Draftsman
      • Piping Drafter
      • Supply Chain Specialist
      • Technical Publication - Illustrator
working in
clear filter
all filters
all filters
where
use current location
type of employment
clear filter
  • 0
selected filters:
mechanical- and industrial engineers
clear all
selected filters:
mechanical- and industrial engineers
clear all
search by
clear all
  • search for
  • where
    use current location
  • add job type
  • select the profesional field of work where you are looking for a job

our professional fields
page 1
  • automation engineer

    • hyderabad, telangana
    • permanent
    • Strong writing, presenting and listening skills with the ability to communicate complicated conceptsto peers around the world• At least 5 years in an automation and controls environment• Bachelor's Degree/Post Graduate Diploma/Professional Degree in Engineering: Mechatronics,Electrical, Electronics, Instrumentation & Control, Automation, Industrial, Computer Systems orrelated discipline• Programming of PLC (Allen Bradley, Siemens, Schneider), HMI and
    23 march 2026
    • Strong writing, presenting and listening skills with the ability to communicate complicated conceptsto peers around the world• At least 5 years in an automation and controls environment• Bachelor's Degree/Post Graduate Diploma/Professional Degree in Engineering: Mechatronics,Electrical, Electronics, Instrumentation & Control, Automation, Industrial, Computer Systems orrelated discipline• Programming of PLC (Allen Bradley, Siemens, Schneider), HMI and
    show job details
  • finance reporting

    • gurgaon, haryana
    • temporary
    Job Title: Financial ReportingLocation: Gurugram (HO)Experience: 1 – 3 YearsDepartment: FinanceReports To: Manager / Senior Manager – Financial ReportingRole ObjectiveThe primary focus of this role is to assist in the preparation, analysis, and submission of accurate financial reports. You will ensure compliance with IRDAI regulations, Indian GAAP, and Ind AS, while supporting the month-end closing process and statutory audits.Key Responsibilities1.
    20 march 2026
    Job Title: Financial ReportingLocation: Gurugram (HO)Experience: 1 – 3 YearsDepartment: FinanceReports To: Manager / Senior Manager – Financial ReportingRole ObjectiveThe primary focus of this role is to assist in the preparation, analysis, and submission of accurate financial reports. You will ensure compliance with IRDAI regulations, Indian GAAP, and Ind AS, while supporting the month-end closing process and statutory audits.Key Responsibilities1.
    show job details
  • design engineer

    • bengaluru, karnataka
    • permanent
    Job Title: Design Engineer - Mechanical Location: Bengaluru Department: Engineering / Mechanical Systems Reports To: Principal Engineer  Job Type: Full-Time Job Summary: We are seeking a skilled and Innovative Mechanical Design Engineer to join our engineering team. The ideal  candidate will be responsible for the Designing, Developing, and improving mechanical systems, components  and products that meets functional, cost, quality and safety requirements
    20 march 2026
    Job Title: Design Engineer - Mechanical Location: Bengaluru Department: Engineering / Mechanical Systems Reports To: Principal Engineer  Job Type: Full-Time Job Summary: We are seeking a skilled and Innovative Mechanical Design Engineer to join our engineering team. The ideal  candidate will be responsible for the Designing, Developing, and improving mechanical systems, components  and products that meets functional, cost, quality and safety requirements
    show job details
  • design engineer

    • bengaluru, karnataka
    • permanent
    Job Title: Design Engineer - Mechanical Location: Bengaluru Department: Engineering / Mechanical Systems Reports To: Principal Engineer  Job Type: Full-Time Job Summary: We are seeking a skilled and Innovative Mechanical Design Engineer to join our engineering team. The ideal  candidate will be responsible for the Designing, Developing, and improving mechanical systems, components  and products that meets functional, cost, quality and safety requirements
    20 march 2026
    Job Title: Design Engineer - Mechanical Location: Bengaluru Department: Engineering / Mechanical Systems Reports To: Principal Engineer  Job Type: Full-Time Job Summary: We are seeking a skilled and Innovative Mechanical Design Engineer to join our engineering team. The ideal  candidate will be responsible for the Designing, Developing, and improving mechanical systems, components  and products that meets functional, cost, quality and safety requirements
    show job details
  • quality surveillance engineer (qse)

    • pune, maharashtra
    • permanent
    Key Responsibilities of the QSE1. Review of Supplier Documentation (70% of Time)Review pre-verification documents such as SMDL (Supplier Master Document List), ITP (Inspection and Test Plan), and Procedures received from the Supplier.Review verification documents against requirements from the PO (Purchase Order), Project/Client specifications, Material specifications, product specific requirements,and applicable codes & standards.Create a COM document in
    18 march 2026
    Key Responsibilities of the QSE1. Review of Supplier Documentation (70% of Time)Review pre-verification documents such as SMDL (Supplier Master Document List), ITP (Inspection and Test Plan), and Procedures received from the Supplier.Review verification documents against requirements from the PO (Purchase Order), Project/Client specifications, Material specifications, product specific requirements,and applicable codes & standards.Create a COM document in
    show job details
  • manager- impex

    • noida, uttar pradesh
    • permanent
    Key ResponsibilitiesDocumentation Management: Prepare and oversee all necessary shipping documents, including Commercial Invoices, Packing Lists, Bills of Lading (BOL), Certificates of Origin, and AES filings.Compliance & Regulations: Ensure all international shipments adhere to local and international laws. Assign correct HS (Harmonized System) Codes and monitor changes in trade agreements or tariffs.Logistics Coordination: Book shipments and negotiate
    18 march 2026
    Key ResponsibilitiesDocumentation Management: Prepare and oversee all necessary shipping documents, including Commercial Invoices, Packing Lists, Bills of Lading (BOL), Certificates of Origin, and AES filings.Compliance & Regulations: Ensure all international shipments adhere to local and international laws. Assign correct HS (Harmonized System) Codes and monitor changes in trade agreements or tariffs.Logistics Coordination: Book shipments and negotiate
    show job details
  • lead piping engineer (revit)

    • chennai, tamil nadu
    • permanent
    Job Title: Lead Piping Engineer (Revit) Key Skills:Autodesk Revit (Piping)Piping layouts, Isometrics, GA & Spool drawingsP&ID interpretationPipe supports & multi-disciplinary coordinationKnowledge of ASME / project standardsExperience in EPC / Oil & Gas / Process / Industrial plantsQualification:B.E / B.Tech – Mechanical or Diploma in MechanicalLocation:Bangalore / Chennai (Hybrid working flexibility)Key Responsibilities: Strong expertise in Autodesk
    17 march 2026
    Job Title: Lead Piping Engineer (Revit) Key Skills:Autodesk Revit (Piping)Piping layouts, Isometrics, GA & Spool drawingsP&ID interpretationPipe supports & multi-disciplinary coordinationKnowledge of ASME / project standardsExperience in EPC / Oil & Gas / Process / Industrial plantsQualification:B.E / B.Tech – Mechanical or Diploma in MechanicalLocation:Bangalore / Chennai (Hybrid working flexibility)Key Responsibilities: Strong expertise in Autodesk
    show job details
  • senior purchase engineer

    • kolar, karnataka
    • permanent
    ※Roles & Responsibility          Supplier identification for Stamping, Resin . Die cast , Spring and other Partrs Floating RFQ and get the Quaotation from supplier New supplier development for new parts and Alternate supplier for Existing. Quotation analysis and compare the Quote with 2 to 3 Supplier         New part development for engine , Transmission and body parts PO preparation and Data Entry in system SAP. Should be cost estimation , negotation
    17 march 2026
    ※Roles & Responsibility          Supplier identification for Stamping, Resin . Die cast , Spring and other Partrs Floating RFQ and get the Quaotation from supplier New supplier development for new parts and Alternate supplier for Existing. Quotation analysis and compare the Quote with 2 to 3 Supplier         New part development for engine , Transmission and body parts PO preparation and Data Entry in system SAP. Should be cost estimation , negotation
    show job details
  • mechanical/plastics engineer

    • bengaluru, karnataka
    • permanent
    Key Responsibilities Confidential information• Design and develop injection-molded and thermo formed plastic components for use in bioprocessing (e.g. drug substance and drug product manufacturing).• Select appropriate polymers and materials based on biocompatibility, extractables/leachables profiles, sterilization compatibility, and mechanical requirements.• Work closely with cross-functional teams (R&D, Manufacturing, Quality, Regulatory, and Supply
    17 march 2026
    Key Responsibilities Confidential information• Design and develop injection-molded and thermo formed plastic components for use in bioprocessing (e.g. drug substance and drug product manufacturing).• Select appropriate polymers and materials based on biocompatibility, extractables/leachables profiles, sterilization compatibility, and mechanical requirements.• Work closely with cross-functional teams (R&D, Manufacturing, Quality, Regulatory, and Supply
    show job details
  • lead engineer

    • thiruporur, tamil nadu
    • temporary
    Job PurposeTo ensure maximum machine uptime and safety in a precision auto-component manufacturing environment (ECU, IG Coil, VTC) through effective electrical maintenance and rapid troubleshooting.Key ResponsibilitiesMaintenance & Troubleshooting: Perform breakdown, preventive (PPM), and corrective maintenance on production machinery (winding, molding, assembly lines).Systems Expertise: Troubleshoot PLCs (Siemens/Mitsubishi), VFDs, Servo drives, HMIs,
    16 march 2026
    Job PurposeTo ensure maximum machine uptime and safety in a precision auto-component manufacturing environment (ECU, IG Coil, VTC) through effective electrical maintenance and rapid troubleshooting.Key ResponsibilitiesMaintenance & Troubleshooting: Perform breakdown, preventive (PPM), and corrective maintenance on production machinery (winding, molding, assembly lines).Systems Expertise: Troubleshoot PLCs (Siemens/Mitsubishi), VFDs, Servo drives, HMIs,
    show job details
  • design engineer

    • pune, maharashtra
    • temporary
    PositionEngineer - Product Engineering- ContractLevelExecutiveLocationPuneMandatory SkillsCreo expertisePlastic or Casting design experience is preferredGood To Have skillsbasic of surface design/surface modelling/PLMDFMEA, DFXHiring ManagerVijay NadgeriCompetitors/ Domain companiesAnyExperienceBachelor of Engineering degree with min. 1-4 years of relevant experienceDiploma with min. 4-5 years of relevant
    14 march 2026
    PositionEngineer - Product Engineering- ContractLevelExecutiveLocationPuneMandatory SkillsCreo expertisePlastic or Casting design experience is preferredGood To Have skillsbasic of surface design/surface modelling/PLMDFMEA, DFXHiring ManagerVijay NadgeriCompetitors/ Domain companiesAnyExperienceBachelor of Engineering degree with min. 1-4 years of relevant experienceDiploma with min. 4-5 years of relevant
    show job details
  • design engineer

    • pune city, maharashtra
    • permanent
    JOB DESCRIPTION Position TitleStructural Senior EngineerDivision / DepartmentStructural Analysis/ StructuresLocationPuneDate (written on)Feb 2024 JOB PURPOSETo manage the assigned structural engineering scope in a project as per schedule with requisite quality. COMPANY OVERVIEW OneSubsea is a division of Schlumberger Limited, a multinational oilfield services company. OneSubsea specializes in providing integrated solutions, products, systems, and services
    13 march 2026
    JOB DESCRIPTION Position TitleStructural Senior EngineerDivision / DepartmentStructural Analysis/ StructuresLocationPuneDate (written on)Feb 2024 JOB PURPOSETo manage the assigned structural engineering scope in a project as per schedule with requisite quality. COMPANY OVERVIEW OneSubsea is a division of Schlumberger Limited, a multinational oilfield services company. OneSubsea specializes in providing integrated solutions, products, systems, and services
    show job details
  • design engineer

    • vandalur, tamil nadu
    • temporary
    Key ResponsibilitiesSurface Development: Create and refine complex 3D surface models using Creo Parametric (ISDX/Interactive Surface Design Extension) and Freestyle modeling.Plastic Design Excellence: Ensure all designs incorporate essential plastic features, including draft angles, wall thickness uniformity, ribs, bosses, and parting lines.Technical Analysis: Perform curvature analysis, draft analysis, and thickness checks to ensure surface quality and
    12 march 2026
    Key ResponsibilitiesSurface Development: Create and refine complex 3D surface models using Creo Parametric (ISDX/Interactive Surface Design Extension) and Freestyle modeling.Plastic Design Excellence: Ensure all designs incorporate essential plastic features, including draft angles, wall thickness uniformity, ribs, bosses, and parting lines.Technical Analysis: Perform curvature analysis, draft analysis, and thickness checks to ensure surface quality and
    show job details
  • tooling engineer

    • maraimalai nagar, tamil nadu
    • permanent
    Key Deliverables (Functions / Activities)ResponsibilitiesMeasurement (KPI)Tooling maintenance based on production requirement.No of tooling deliveryOn-line trouble shooting for dimensional & die related problems.Tooling Breakdown %Follow all QMS procedures and documentations related to Tool shop100% on-time certification and ensure zero major NCInternal InteractionsRole - FunctionFrequency of InteractionPurposeProductionDailyTooling requirementsPurchase &
    12 march 2026
    Key Deliverables (Functions / Activities)ResponsibilitiesMeasurement (KPI)Tooling maintenance based on production requirement.No of tooling deliveryOn-line trouble shooting for dimensional & die related problems.Tooling Breakdown %Follow all QMS procedures and documentations related to Tool shop100% on-time certification and ensure zero major NCInternal InteractionsRole - FunctionFrequency of InteractionPurposeProductionDailyTooling requirementsPurchase &
    show job details
  • maintenance engineer

    • chennai, tamil nadu
    • permanent
    Conduct daily inspection of equipment, conduct tests, and promptly address any unusual situations that may arise.2.Effectively manage the budget allocated for maintenance, including resource allocation for necessary repairs and replacements.3.Enforce strict adherence to safety policies and procedures among departmental staff.4.Monitor factory operations to promptly resolve any maintenance related issues and optimize production efficiency.5. control and
    11 march 2026
    Conduct daily inspection of equipment, conduct tests, and promptly address any unusual situations that may arise.2.Effectively manage the budget allocated for maintenance, including resource allocation for necessary repairs and replacements.3.Enforce strict adherence to safety policies and procedures among departmental staff.4.Monitor factory operations to promptly resolve any maintenance related issues and optimize production efficiency.5. control and
    show job details
  • sourcing and purchase requisition analyst

    • navi mumbai panvel raigarh, maharashtra
    • permanent
    Sourcing and Purchase Requisition analyst  Industry - Service IndustryLocation - Mumbai Purchase Requisition (PR) Support Review submitted PRs in the ERP/e-procurement system; ensure correct vendor, item/service descriptions, pricing, GL coding, cost center and approval routing.Track PR approvals, follow up with requesters/approvers to resolve queries and expedite approvals.Close or cancel PRs as required (partial/complete closure), ensuring appropriate
    11 march 2026
    Sourcing and Purchase Requisition analyst  Industry - Service IndustryLocation - Mumbai Purchase Requisition (PR) Support Review submitted PRs in the ERP/e-procurement system; ensure correct vendor, item/service descriptions, pricing, GL coding, cost center and approval routing.Track PR approvals, follow up with requesters/approvers to resolve queries and expedite approvals.Close or cancel PRs as required (partial/complete closure), ensuring appropriate
    show job details
  • senior production engineer

    • kolar, karnataka
    • permanent
    Job Description Roles & ResponsibilityDevelop Stamping process by understanding the parts drawing.Prepare Die specifications.Floating RFQ for stamping dies to Tool makersPrepare Line capacity and add capacity based on customer demand.Die design review and Manufacturing supportAchieve stamping parts accuracy and die prove outHome line trails and support for Die Maintenance.Prepare Spare parts of machines and dies order and hand over to Maintenance
    11 march 2026
    Job Description Roles & ResponsibilityDevelop Stamping process by understanding the parts drawing.Prepare Die specifications.Floating RFQ for stamping dies to Tool makersPrepare Line capacity and add capacity based on customer demand.Die design review and Manufacturing supportAchieve stamping parts accuracy and die prove outHome line trails and support for Die Maintenance.Prepare Spare parts of machines and dies order and hand over to Maintenance
    show job details
  • deputy manager

    • chennai, tamil nadu
    • permanent
    Exposure in other treasury areasL/C , SBLC , BG , Buyers credit. -Working capital  term sheet review.SAP accounting - treasury transactions.Forex HedgingCash flow ManagementEDPMS & IDPMS - YES  experience10
    10 march 2026
    Exposure in other treasury areasL/C , SBLC , BG , Buyers credit. -Working capital  term sheet review.SAP accounting - treasury transactions.Forex HedgingCash flow ManagementEDPMS & IDPMS - YES  experience10
    show job details
  • level 3 senior detection engineer

    • bangalore, karnataka
    • permanent
    About Woodside Energy  We are a global energy company, providing reliable and affordable energy to help people lead better lives. Join our team at Woodside Global Solutions in Bengaluru where talent, digital expertise, and operational excellence converge to solve complex energy challenges, accelerate change, and reimagine business capabilities to support Woodside's global operations and our role in the energy transition.Founded in 1954, Woodside
    9 march 2026
    About Woodside Energy  We are a global energy company, providing reliable and affordable energy to help people lead better lives. Join our team at Woodside Global Solutions in Bengaluru where talent, digital expertise, and operational excellence converge to solve complex energy challenges, accelerate change, and reimagine business capabilities to support Woodside's global operations and our role in the energy transition.Founded in 1954, Woodside
    show job details
  • level 2 detection engineer

    • bengaluru, karnataka
    • permanent
    About Woodside Energy   We are a global energy company, providing reliable and affordable energy to help people lead better lives. Join our team at Woodside Global Solutions in Bengaluru where talent, digital expertise, and operational excellence converge to solve complex energy challenges, accelerate change, and reimagine business capabilities to support Woodside's global operations and our role in the energy transition.  Founded in 1954, Woodside
    9 march 2026
    About Woodside Energy   We are a global energy company, providing reliable and affordable energy to help people lead better lives. Join our team at Woodside Global Solutions in Bengaluru where talent, digital expertise, and operational excellence converge to solve complex energy challenges, accelerate change, and reimagine business capabilities to support Woodside's global operations and our role in the energy transition.  Founded in 1954, Woodside
    show job details
  • head - materials and stores

    • thane, maharashtra
    • permanent
    Role:  • Lead and manage procurement process for all material and service requirements of MBD• Establish procurement processes including analyzing market, reviewing supplier base, setting pricing structure, benchmarking with competitors and supplier management• Float RFPs to existing and potential suppliers in case of new material / service requirements• Oversee negotiations with approved suppliers for procurement within budget; closely monitor
    9 march 2026
    Role:  • Lead and manage procurement process for all material and service requirements of MBD• Establish procurement processes including analyzing market, reviewing supplier base, setting pricing structure, benchmarking with competitors and supplier management• Float RFPs to existing and potential suppliers in case of new material / service requirements• Oversee negotiations with approved suppliers for procurement within budget; closely monitor
    show job details
  • repair engineer

    • peenya small industries, karnataka
    • permanent
    Identification of components & Packages.  Understanding of datasheets.Awareness of BIOS functions, re-programming.Capable of testing of all the passive & active components.Repair related to all function failures (fault related to associated circuit)Expert to diagnose the circuit voltages & signals.experience6
    6 march 2026
    Identification of components & Packages.  Understanding of datasheets.Awareness of BIOS functions, re-programming.Capable of testing of all the passive & active components.Repair related to all function failures (fault related to associated circuit)Expert to diagnose the circuit voltages & signals.experience6
    show job details
  • drivetrain design engineer

    • chennai, tamil nadu
    • temporary
    Job ScopeThe candidate will serve as the principal contributor for transmission system modeling and detailing within the Drivetrain India team, ensuring high standards of modeling and drawing quality. This role may be designated as “Transmission Modeler/Detailer”. The position requires demonstrated expertise in advanced surface casting modeling and handling complex group-level assemblies.Key Duties and Responsibilities Perform modeling and detailing of
    6 march 2026
    Job ScopeThe candidate will serve as the principal contributor for transmission system modeling and detailing within the Drivetrain India team, ensuring high standards of modeling and drawing quality. This role may be designated as “Transmission Modeler/Detailer”. The position requires demonstrated expertise in advanced surface casting modeling and handling complex group-level assemblies.Key Duties and Responsibilities Perform modeling and detailing of
    show job details
  • manager d2c

    • gurgaon road, delhi
    • permanent
    Role OverviewWe are looking for a D2C Growth Manager who will own and drive end-to-end growthacross the D2C website and digital channels. This role requires a hands-on growth leaderwho can balance performance marketing, conversion optimization, retention, and analyticsto scale revenue efficiently. Key ResponsibilitiesGrowth & Revenue• Own D2C revenue targets and growth metrics (traffic, conversion, AOV, LTV, CAC)• Build and execute growth strategies
    6 march 2026
    Role OverviewWe are looking for a D2C Growth Manager who will own and drive end-to-end growthacross the D2C website and digital channels. This role requires a hands-on growth leaderwho can balance performance marketing, conversion optimization, retention, and analyticsto scale revenue efficiently. Key ResponsibilitiesGrowth & Revenue• Own D2C revenue targets and growth metrics (traffic, conversion, AOV, LTV, CAC)• Build and execute growth strategies
    show job details
  • process associate

    • bengaluru, karnataka
    • temporary
    Designation:Process accosiate Fresher -1years Duration:6monthCTC Offered:3lpaLaptop is must with Windows 10 with 16GB RAMShift :Night and rotational shift Location:Bangalore  Fluent in English – spoken and writtenProficient in MS Office, including Excel, Access and PowerPointKnowledge on Fixed Income, Equities, Derivatives & FX related products & Money Market productsExperience with vendor systems – Refinitiv & Bloomberg data feedExcellent attention to
    3 march 2026
    Designation:Process accosiate Fresher -1years Duration:6monthCTC Offered:3lpaLaptop is must with Windows 10 with 16GB RAMShift :Night and rotational shift Location:Bangalore  Fluent in English – spoken and writtenProficient in MS Office, including Excel, Access and PowerPointKnowledge on Fixed Income, Equities, Derivatives & FX related products & Money Market productsExperience with vendor systems – Refinitiv & Bloomberg data feedExcellent attention to
    show job details
  • field service engineer

    • pune new bazar, maharashtra
    • permanent
    Roles -    1)Supporting customers through technical and administrative activities   2)Understanding customer needs and concerns   3) Providing a high level of customer service   4) Preparing and submitting service reports   5) Providing technical direction to the team   6) Participating in the training of new team members   7) Work under pressure and meet tight deadlinesexperience10
    3 march 2026
    Roles -    1)Supporting customers through technical and administrative activities   2)Understanding customer needs and concerns   3) Providing a high level of customer service   4) Preparing and submitting service reports   5) Providing technical direction to the team   6) Participating in the training of new team members   7) Work under pressure and meet tight deadlinesexperience10
    show job details
  • rpa senior specialist

    • chennai, tamil nadu
    • permanent
    Requirements: ·         Bachelor’s degree in computer science, Engineering, or related field (or equivalent work experience) ·         Minimum 4 years and not more than 7 years of overall IT experience ·         Minimum 2 years and not more than 3 years of proven experience in designing and developing RPA solutions using UiPath with a strong understanding of RPA concepts and best practices. ·         UiPath Certification is mandatory·         Proficiency
    2 march 2026
    Requirements: ·         Bachelor’s degree in computer science, Engineering, or related field (or equivalent work experience) ·         Minimum 4 years and not more than 7 years of overall IT experience ·         Minimum 2 years and not more than 3 years of proven experience in designing and developing RPA solutions using UiPath with a strong understanding of RPA concepts and best practices. ·         UiPath Certification is mandatory·         Proficiency
    show job details
  • sr associate

    • gurgoan, uttar pradesh
    • permanent
    PositionResponsibilities: PriortizedatagatheredfromfinancialreportsintoExcelworkbookanalysesthatprovidesvaluableguidancetotheU.S.basedengagementteamonspecificreviewsofcompanyfinancialsinthefast-pacedworldofmergersandacquisitions Prepareandupdatedocumentrequestlistsandmanagementmeetingagendas ParticipateinmanagementmeetingswiththeTargetCompanyanddiscussionswiththeClient
    28 february 2026
    PositionResponsibilities: PriortizedatagatheredfromfinancialreportsintoExcelworkbookanalysesthatprovidesvaluableguidancetotheU.S.basedengagementteamonspecificreviewsofcompanyfinancialsinthefast-pacedworldofmergersandacquisitions Prepareandupdatedocumentrequestlistsandmanagementmeetingagendas ParticipateinmanagementmeetingswiththeTargetCompanyanddiscussionswiththeClient
    show job details
  • service engineer

    • bengaluru, karnataka
    • temporary
    Greesting From randstad ! Service,car serviceCommecial vehicle servicemachine service,technician experience5
    27 february 2026
    Greesting From randstad ! Service,car serviceCommecial vehicle servicemachine service,technician experience5
    show job details
  • r&d head

    • sanand, gujarat
    • permanent
    As the Head of Research and Development (R&D) you will lead a team of talented researchers and engineers to drive innovaƟon and product development iniƟaƟves. This role requires a strategic thinker with a strong technical background, excepƟonal leadership skills, and a track record of successfully managing R&D projects in India. It will Involve close coordinaƟon and working along with our Global R&D headquarter in Germany.Key Responsibilities: Lead and
    27 february 2026
    As the Head of Research and Development (R&D) you will lead a team of talented researchers and engineers to drive innovaƟon and product development iniƟaƟves. This role requires a strategic thinker with a strong technical background, excepƟonal leadership skills, and a track record of successfully managing R&D projects in India. It will Involve close coordinaƟon and working along with our Global R&D headquarter in Germany.Key Responsibilities: Lead and
    show job details
    30 of 98 jobs seen
    illustration of an email being received

    let similar jobs come to you

    we will keep you updated when we have similar job postings.

    mechanical- and industrial engineers jobs by region

      • gujarat (6)
      • karnataka (30)
      • maharashtra (20)
      • tamil nadu (20)
      • telangana (8)
      • uttar pradesh (3)

    mechanical- and industrial engineers jobs by subspecialism

      • technicians and engineers -industry and mechanical engineering (34)
      • technicians and engineers not elsewhere classified (64)